SecReT6
Protein ID: 392981500
SecReT6 ID674
T6SS typei3
Gene symbol-
Locus tagPADK2_00450
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]103228..104013 [+]
Productsecretion protein
NoteTagJ
UniProt IDI6RRK1
KEGG IDpdk:PADK2_00450
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.30E-43, Aligned region: 139..256
TPR_16 [PF13432], Evalue: 1.30E-07, Aligned region: 2..54
TPR_16 [PF13432], Evalue: 1.30E-07, Aligned region: 112..130
TPR_19 [PF14559], Evalue: 2.30E-05, Aligned region: 6..62
TPR_19 [PF14559], Evalue: 2.30E-05, Aligned region: 111..131
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 2..39
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 36..53
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 93..121
TPR_11 [PF13414], Evalue: 0.0037, Aligned region: 3..51
TPR_11 [PF13414], Evalue: 0.0037, Aligned region: 102..119
Protein Sequence: 261 a.a.     [Download]
>gi|392981500|ref|YP_006480087.1| secretion protein [Pseudomonas aeruginosa DK2]
MIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMGQWARAQNQLKVVGELDASALPMVQTY
STAIDCEALRREVFAGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAP
FAWLADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVALLPARYAE
TVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTDA
 
Nucleotide Sequence: 786 bp     [Download]
>gi|392981410|ref|NC_018080.1|:103228-104013 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGATCGCCGAAGAACTGTTGCGCGCCGGGCGCCTGGACGATGCCTTGAAAGCCTTGCAGGAACAGGTGC
GCAGCCAGCCGTCGAACGCTACCCTGCGGATCTTTCTGTTCCAGCTGCTGGCCGTGATGGGCCAGTGGGC
GCGGGCGCAGAACCAGCTCAAGGTGGTCGGCGAACTGGATGCCTCGGCGCTGCCGATGGTACAGACCTAC
TCCACCGCCATCGACTGCGAGGCGCTGCGCCGCGAGGTGTTCGCCGGGCGCCTGACGCCGGTGATCCTCG
GCCAGCCGGCGGAATGGATCGCGCCGCTGTTGCAGGCCCTGAGCCTGGACGCCGAAGGCCATGGCGAGGC
CGCCCAGGCCCTGCGCGAGCAGGCCTTCGACGCCGCGCCGGCGGTGCCCGGGCGGATCGGCGAAGCGCCG
TTCGCCTGGCTGGCGGATGCCGACACGCGCCTCGGCCCGGTGCTCGAGGTAATCGTCAACGGTCGCTATG
CCTGGTTGCCGATGAGCAACCTGCGCAGCCTCAAGGTCGAGGCGCCGAGCGACCTGCGCGATCTGGTCTG
GCTGCCGGCCGAACTGACCCTGGCCAACGGTGGCGCCACCGTCGCGCTGCTGCCGGCGCGCTACGCGGAA
ACCGTCGAGCACGGCGACGACGCCGCGCGCCTGGGGCGCAAGACCGAATGGCTGGACAGCGGCCTGCCGG
TCGGCCAGCGGCTGTTCGTCACCGATGCCGGCGAGACCGCGCTGTTCGACCTGCGTGAACTGGACTTCGA
GCCGACGGACGCCTGA