SecReT6
Protein ID: 392981503
SecReT6 ID674
T6SS typei3
Gene symbol-
Locus tagPADK2_00465
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]106344..107390 [+]
Producthypothetical protein
NoteTssG
UniProt IDI6SKY6
KEGG IDpdk:PADK2_00465
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-112, Aligned region: 20..319
Protein Sequence: 348 a.a.     [Download]
>gi|392981503|ref|YP_006480090.1| hypothetical protein PADK2_00465 [Pseudomonas aeruginosa DK2]
MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRLGHSVRLADDPLRLGQKPDCTFAPSTL
ASVSQAGTAAVPRLDQFFFGLTGPNGPLPLHLTEYARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEA
RPEISHDRIDDDYWSARLAALSGRGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVA
VEEYVGQWLELPERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWV
AEYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPHEHKEKEHE
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|392981410|ref|NC_018080.1|:106344-107390 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGAACCTGCTCGCCGGGATGGCGGCGGCGCCCTGGG
ACTATGACTTCTTCCAGGCGCTGCGGCGCATCGAGTGCGAGTCGCCGCAACTGCCGCGCCTCGGTCATTC
GGTGCGGCTGGCGGACGACCCGCTGCGTCTCGGGCAGAAGCCCGACTGCACCTTCGCGCCCTCGACCCTG
GCCTCGGTGAGCCAGGCCGGCACCGCTGCGGTGCCGCGCCTGGACCAGTTCTTCTTCGGCCTCACCGGCC
CCAACGGGCCGCTGCCGCTGCACCTCACCGAATACGCCCGGGAACGCCAGCGCAACGTCAACGACGCGAC
CTTCAAGCGCTTCATGGACGTCTTCCACCACCGCCTGCTGACCCTGTTCTACCGGGCCTGGGCCGAGGCG
CGGCCGGAGATCAGCCACGACCGGATCGACGACGACTACTGGTCGGCGCGCCTCGCCGCGCTCTCCGGGC
GCGGCATGCCGAGCCTGCGGGGGCGCGAGCCGCTGGCGGATACCGCACGCTACTACTACACCGGCCACCT
CGCCGCGCAGACCCGCTACCCGGACGGCCTGCGGGTGATCCTCGCGGAGTATTTCGAGGTCCCGGTGGCG
GTCGAGGAATACGTCGGCCAATGGCTGGAGCTGCCCGAGCGCAGCCGCCTCGGCGTCGACTCGACGAGCC
TGGGCATGGACGTCTGCCTGGGCACCCACGTCTGGGACCGCCAGCACAAGTTCCGCCTGCGCCTGGGGCC
GCTGGACCTCGATCAATACCAGCGCTTCCTGCCCGACGGCGACCACTTCGTCGAGCTGGCCGCCTGGGTC
GCCGAATACCTGGGCGAGGAGCTGGACTGGGACGTCAACCTGGTCCTGCAACGCCACGAAGTACCCCCGC
TGGGCCTGCAGGGCGGCGGGCGGCTCGGTTTCAACACCTGGCTGGGCGATCCCGGCCAGGACGCCAGGGA
TCTACTGCTGGCCCGCCAGTACGCCACTGCGCGGCCGCACGAGCACAAGGAGAAGGAACATGAGTGA