SecReT6
Protein ID: 392984076
SecReT6 ID675
T6SS typei4a
Gene symbol-
Locus tagPADK2_13400
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]2884928..2886832 [-]
Producthypothetical protein
NoteTssI
UniProt IDI6SX24
KEGG IDpdk:PADK2_13400
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-68, Aligned region: 15..288
Phage_base_V [PF04717], Evalue: 4.80E-23, Aligned region: 317..410
Gp5_C [PF06715], Evalue: 2.50E-15, Aligned region: 467..489
Gp5_C [PF06715], Evalue: 2.50E-15, Aligned region: 502..523
Gp5_C [PF06715], Evalue: 2.50E-15, Aligned region: 526..549
Gp5_C [PF06715], Evalue: 2.50E-15, Aligned region: 607..620
Protein Sequence: 634 a.a.     [Download]
>gi|392984076|ref|YP_006482663.1| hypothetical protein PADK2_13400 [Pseudomonas aeruginosa DK2]
MDSMSLQGNSSTSLTLSNTVASHLSATLHNDSQQRPLDALVAEIHQLPADATADRFQLVLRPWLWWLTLA
SNNRVFQNLATSDIVTTIFKAHGFTDFKLSLTGSYEPREYCVQYGETDFAFVSRLLEEEGIFWFFIHEVG
KHTLVLADSNDAFPPIPNGPKVPYLDQEIGVRELHGIRSAQYCLQAVAGTYSATDYEFTTPSTSLYSQAQ
AEAGPRARYEHPGGYTAKGRGDALTKQRVDGLRSQEKRLIGESDCRWLVPGHWFTLSGHDDDSLNIDWVL
TSVTHDASHAHYRNRFEAIPKATAYRPARVTPKPRMHTQTALVVGKAGEEIWTDQYGRIKIQFPWDRDGK
NDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVTFIDGDPDRPLVTGCVYNGDNALPYALPDNQTQSGI
KTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDLNVNVLNDSTASIGHDETLTVQNARTRTVKEGDETVTL
EKGKRTVTIQTGSDSLDVKDTRTVTVGADQTHSTGGNYSHKVSGDFELTVDGNLTIKVSGTLALQSGGSL
TLKSDADLAAQAGTSLTSKAGTSLTNQAGTSLTNKAGTSLTNDAGVSLTNKAGAEQTVDGGGMLTIKGGL
VKVN
 
Nucleotide Sequence: 1905 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c2886832-2884928 Pseudomonas aeruginosa DK2 chromosome, complete genome
TTGGACAGCATGTCTCTCCAGGGCAACAGCTCCACGTCGCTGACACTATCCAACACCGTCGCCTCGCACC
TCAGCGCCACCCTGCACAACGACTCCCAGCAACGCCCCCTCGACGCCCTGGTCGCCGAAATCCACCAGCT
CCCCGCCGACGCAACTGCCGACCGTTTTCAACTCGTACTCAGACCATGGCTCTGGTGGCTGACCCTGGCC
AGCAACAACCGCGTGTTCCAGAACCTCGCCACCAGCGACATCGTCACCACGATCTTCAAGGCCCACGGCT
TCACCGACTTCAAGCTGTCGCTGACCGGCAGCTACGAGCCCCGTGAATACTGCGTGCAGTACGGCGAGAC
CGACTTCGCCTTCGTCTCGCGCCTGCTGGAGGAGGAAGGCATCTTCTGGTTCTTCATCCACGAAGTGGGC
AAGCACACGTTGGTGCTGGCGGACAGCAACGACGCCTTCCCGCCGATCCCCAACGGGCCCAAGGTGCCAT
ACCTGGACCAGGAGATCGGCGTGCGCGAACTGCACGGCATCCGTTCGGCGCAGTACTGCCTGCAGGCGGT
CGCCGGGACCTACAGCGCCACCGACTACGAGTTCACCACACCCAGTACTTCGCTCTATTCCCAGGCACAG
GCCGAGGCCGGGCCGCGCGCACGGTACGAACACCCCGGCGGCTACACCGCCAAGGGCCGCGGCGATGCGC
TGACCAAGCAGCGCGTGGACGGCCTGCGCAGCCAGGAAAAGCGCCTGATCGGCGAGAGCGACTGCCGCTG
GCTGGTGCCCGGCCACTGGTTCACCCTCAGCGGGCATGACGACGATTCGCTGAATATCGACTGGGTGCTG
ACCTCGGTCACCCATGACGCCAGTCACGCGCACTACCGCAACCGCTTCGAGGCGATCCCCAAGGCCACCG
CCTACCGCCCCGCGCGGGTCACGCCCAAGCCGCGCATGCACACCCAGACCGCCCTGGTGGTGGGCAAGGC
CGGCGAGGAGATCTGGACCGACCAGTACGGCCGGATCAAGATCCAGTTCCCCTGGGACCGCGACGGCAAG
AACGACGAGACCTCCTCCTGCTGGGTGCGCGTGGTGCTGCCCTGGAGCGGCAAGGGCTTCGGCATGCAGT
TCGTGCCGCGCATCGGCCAGGAAGTGATCGTCACCTTCATCGACGGCGACCCGGACCGCCCGCTGGTCAC
CGGCTGCGTCTACAACGGCGACAACGCCCTGCCCTACGCGCTGCCGGACAACCAGACGCAGTCCGGGATC
AAGACCAACTCGTCGAAGGGCGGCGGCGGTTTCAACGAGCTGCGCTTCGAGGACAAGAAGGACGCCGAGG
AAGTCTTCCTCCAGGCGCAGAAGGACCTCAACGTCAACGTGCTCAACGACAGCACCGCCAGCATCGGCCA
CGACGAGACCCTGACGGTGCAGAACGCCCGCACCCGCACGGTGAAGGAAGGCGACGAGACCGTCACCCTG
GAGAAAGGCAAGCGCACGGTGACCATCCAGACCGGCAGCGACAGCCTGGATGTGAAGGACACGCGCACGG
TGACGGTGGGCGCCGACCAGACCCACAGCACCGGCGGCAACTACAGCCACAAGGTCAGCGGCGACTTCGA
GCTGACGGTGGACGGCAACCTGACCATCAAGGTCAGCGGCACCCTCGCCCTGCAGAGCGGCGGCAGCCTG
ACCCTGAAGAGCGACGCCGACCTCGCCGCCCAGGCTGGCACCTCGCTGACCAGCAAGGCCGGGACGTCGC
TGACCAACCAGGCCGGCACCTCCCTCACCAACAAGGCCGGCACCAGCCTGACCAACGATGCCGGCGTCAG
CCTGACCAACAAGGCCGGCGCCGAACAGACGGTGGACGGCGGCGGCATGCTGACCATCAAGGGCGGCCTG
GTAAAGGTCAACTGA