SecReT6
Protein ID: 392984079
SecReT6 ID675
T6SS typei4a
Gene symbol-
Locus tagPADK2_13415
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]2888759..2891308 [-]
ProductClpA/B-type protease
NoteTssH
UniProt IDI6SIZ5
KEGG IDpdk:PADK2_13415
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-37, Aligned region: 220..296
AAA_2 [PF07724], Evalue: 1.50E-37, Aligned region: 611..775
AAA [PF00004], Evalue: 8.50E-21, Aligned region: 220..350
AAA [PF00004], Evalue: 8.50E-21, Aligned region: 464..519
AAA [PF00004], Evalue: 8.50E-21, Aligned region: 617..734
AAA_5 [PF07728], Evalue: 8.80E-15, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 8.80E-15, Aligned region: 296..350
AAA_5 [PF07728], Evalue: 8.80E-15, Aligned region: 616..735
Clp_N [PF02861], Evalue: 6.40E-12, Aligned region: 21..71
Clp_N [PF02861], Evalue: 6.40E-12, Aligned region: 100..125
AAA_22 [PF13401], Evalue: 3.80E-09, Aligned region: 220..301
AAA_22 [PF13401], Evalue: 3.80E-09, Aligned region: 336..392
AAA_22 [PF13401], Evalue: 3.80E-09, Aligned region: 615..720
AAA_16 [PF13191], Evalue: 4.50E-08, Aligned region: 68..68
AAA_16 [PF13191], Evalue: 4.50E-08, Aligned region: 197..240
AAA_16 [PF13191], Evalue: 4.50E-08, Aligned region: 264..298
AAA_16 [PF13191], Evalue: 4.50E-08, Aligned region: 410..535
AAA_16 [PF13191], Evalue: 4.50E-08, Aligned region: 606..657
AAA_16 [PF13191], Evalue: 4.50E-08, Aligned region: 681..708
AAA_19 [PF13245], Evalue: 2.40E-06, Aligned region: 217..242
AAA_19 [PF13245], Evalue: 2.40E-06, Aligned region: 613..638
ClpB_D2-small [PF10431], Evalue: 3.10E-06, Aligned region: 781..848
AAA_14 [PF13173], Evalue: 5.30E-06, Aligned region: 220..301
AAA_14 [PF13173], Evalue: 5.30E-06, Aligned region: 615..706
Sigma54_activat [PF00158], Evalue: 2.00E-05, Aligned region: 243..262
Sigma54_activat [PF00158], Evalue: 2.00E-05, Aligned region: 615..733
Zeta_toxin [PF06414], Evalue: 2.40E-05, Aligned region: 220..240
Zeta_toxin [PF06414], Evalue: 2.40E-05, Aligned region: 610..656
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 220..261
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 519..535
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 620..653
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 214..239
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 616..636
AAA_18 [PF13238], Evalue: 0.00027, Aligned region: 220..240
AAA_18 [PF13238], Evalue: 0.00027, Aligned region: 620..651
FtsK_SpoIIIE [PF01580], Evalue: 0.00062, Aligned region: 201..261
FtsK_SpoIIIE [PF01580], Evalue: 0.00062, Aligned region: 438..531
NACHT [PF05729], Evalue: 0.00086, Aligned region: 220..248
NACHT [PF05729], Evalue: 0.00086, Aligned region: 617..641
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 274..317
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 434..508
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 613..641
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 787..804
T2SE [PF00437], Evalue: 0.0012, Aligned region: 209..236
T2SE [PF00437], Evalue: 0.0012, Aligned region: 591..685
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 220..268
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 435..451
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 617..636
ResIII [PF04851], Evalue: 0.0021, Aligned region: 211..241
ResIII [PF04851], Evalue: 0.0021, Aligned region: 288..301
ResIII [PF04851], Evalue: 0.0021, Aligned region: 602..638
RNA_helicase [PF00910], Evalue: 0.0055, Aligned region: 221..241
RNA_helicase [PF00910], Evalue: 0.0055, Aligned region: 618..638
AAA_29 [PF13555], Evalue: 0.0097, Aligned region: 210..236
AAA_29 [PF13555], Evalue: 0.0097, Aligned region: 614..641
Protein Sequence: 849 a.a.     [Download]
>gi|392984079|ref|YP_006482666.1| ClpA/B-type protease [Pseudomonas aeruginosa DK2]
MELAALIGRLNPDCRRALERAAQRCLQRTHHYVEIEHLLLELLDIDGGDFACLLPRFGLERDALVAEINL
SLELFKAGNTRTPALSAHTIGLLEDAVVHASVLGQAQIRSGLLLLALLDREERRALLLNSASSLLRIPHE
ALQANLLEWIQASREQPPAPNRPAAGGDKPESAPDPLLDQYTQDLTAEARAGRIDPIVGRDGEIRQCVDI
LLRRRQNNPILVGAPGVGKTAVVEGLALRIAAGEVPPSLQEVILRVLDLGLLQAGASMKGEFEQRLKGVI
DAVRNSAQPIILFIDEAHTLIGAGGAEGGSDAANLLKPALARGELRTLAATTWLEYKKYFEKDPALTRRF
QLVQVEEPDEATAVEMLRGVAGKLELHHGVQIMDAAIVDAVKLSHRYISGRQLPDKAISVLDTACARVAL
GQHDVPPPLESLRHREQALEEELQRLRREQATGLDHSARITALESESGDNRRTIRELETRWDEEREAVRE
LLDTRRELLALSESADAAKPDEELDGRIDHLAAELARLAAGLEAIRQDDPLVPEQVDSRTVAAVIAGWTG
IPVGKMLADEAHAIRSLAQRMGQRVMGQEAALGAIAQRIQAYRAGLSDPAKPVGVFLLPGPTGVGKTETA
YALADALYGGERNLISINLSEYQEAHTVSQLKGAPPGYVGYGSGGVLTEAVRRKPYSVVLLDEIEKAHPD
VLEAFYNVFDKGVMEDGTGLVVDFRNTVILATSNVGAELLLDSPAEQVATPAFDERLRKVLLQTFRPAFL
ARMTVVPYRPLEEATLEGIVVAKLEKLRERYKAATGKQFDFDPAIVKAVLAKCRAAGARDIENVLMAQVT
GKLAEWVLE
 
Nucleotide Sequence: 2550 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c2891308-2888759 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGGAACTCGCCGCCCTGATCGGCCGCCTCAACCCGGACTGTCGCCGCGCCCTGGAGCGCGCCGCGCAAC
GCTGCCTGCAACGCACCCATCATTACGTAGAGATCGAGCACCTGCTGCTGGAGCTGCTGGACATCGACGG
CGGCGACTTCGCCTGCCTGCTGCCGCGCTTCGGCCTGGAGCGCGACGCCCTGGTCGCCGAGATCAACCTG
TCGCTGGAGCTGTTCAAGGCCGGCAATACCCGCACTCCGGCGCTGTCCGCGCACACCATCGGCCTGCTCG
AAGACGCCGTGGTCCACGCCAGCGTGCTCGGCCAGGCGCAGATCCGTTCCGGCCTGCTGCTGCTCGCCCT
GCTCGACCGCGAGGAGCGCCGCGCCCTGCTGCTGAACAGCGCGTCGTCGCTACTGCGGATTCCCCACGAG
GCCTTGCAGGCCAACCTGCTGGAGTGGATCCAGGCCTCCCGCGAACAGCCGCCCGCGCCGAACCGCCCGG
CGGCAGGCGGCGACAAGCCGGAAAGCGCCCCGGACCCGCTGCTCGACCAGTACACCCAGGACCTCACCGC
CGAAGCCCGCGCCGGGCGCATCGACCCCATAGTCGGGCGCGACGGGGAGATCCGCCAGTGCGTCGACATC
CTCCTGCGCCGGCGGCAGAACAACCCGATCCTGGTCGGCGCGCCGGGCGTCGGCAAGACCGCGGTGGTCG
AGGGCCTGGCCCTGCGCATCGCCGCCGGCGAGGTGCCGCCGTCGTTGCAGGAGGTGATCCTGCGGGTGCT
CGACCTCGGCCTGTTGCAGGCCGGCGCCAGCATGAAGGGCGAGTTCGAGCAGCGCCTCAAGGGCGTGATC
GACGCCGTGCGCAACAGCGCGCAGCCGATCATCCTGTTCATCGACGAGGCGCACACGCTGATCGGCGCCG
GCGGCGCGGAAGGCGGCAGCGACGCCGCCAACCTGCTCAAGCCGGCCCTGGCGCGCGGCGAGTTGCGCAC
CCTGGCGGCCACCACCTGGCTGGAATACAAGAAATACTTCGAGAAGGACCCGGCGCTGACCCGGCGCTTC
CAGCTGGTCCAGGTCGAGGAGCCGGACGAGGCCACCGCCGTGGAGATGCTGCGCGGCGTCGCCGGCAAGC
TGGAACTGCATCACGGCGTGCAGATCATGGACGCGGCCATCGTCGATGCGGTGAAGCTGTCGCATCGCTA
CATTTCCGGCCGCCAGTTGCCGGACAAGGCGATCAGCGTGCTCGACACCGCCTGCGCGCGGGTCGCCCTC
GGCCAGCACGACGTGCCGCCGCCGCTGGAAAGCCTGCGCCATCGCGAGCAGGCCCTGGAAGAGGAATTGC
AGCGGCTGCGCCGGGAACAGGCCACCGGCCTCGACCACAGCGCGCGTATCACCGCCCTGGAAAGCGAGTC
GGGCGATAACCGCCGGACCATCCGCGAGCTGGAGACCCGCTGGGACGAGGAACGCGAAGCGGTGCGCGAA
CTGCTCGACACCCGCCGCGAACTGCTGGCCCTCAGCGAAAGCGCCGACGCGGCCAAGCCCGACGAGGAAC
TGGACGGTCGCATCGACCACCTGGCCGCCGAACTGGCGCGCCTGGCGGCCGGCCTCGAAGCCATCCGCCA
GGACGACCCGCTGGTTCCCGAGCAGGTGGACTCGCGTACCGTGGCCGCGGTGATCGCCGGCTGGACCGGC
ATCCCGGTGGGCAAGATGCTCGCCGACGAAGCCCACGCCATCCGTTCCCTGGCGCAACGAATGGGCCAGC
GGGTGATGGGCCAGGAGGCCGCCCTGGGCGCCATCGCCCAGCGCATCCAGGCCTATCGCGCCGGACTCAG
CGACCCGGCCAAGCCGGTCGGCGTATTCCTCCTGCCCGGCCCCACCGGCGTGGGCAAGACCGAGACCGCC
TACGCCCTGGCCGACGCCCTCTACGGCGGCGAACGCAACCTGATCAGCATCAACCTCTCCGAGTACCAGG
AAGCCCACACCGTCAGCCAGCTCAAGGGCGCCCCGCCCGGCTACGTCGGCTACGGCAGCGGCGGCGTGCT
CACCGAAGCGGTGCGCCGCAAGCCCTATTCGGTGGTGCTGCTGGACGAGATCGAGAAAGCCCATCCGGAC
GTGCTGGAAGCCTTCTACAACGTGTTCGACAAGGGCGTGATGGAAGACGGCACCGGCCTGGTGGTGGACT
TCAGGAACACCGTGATCCTCGCCACCAGCAACGTCGGCGCCGAACTGCTGCTGGACAGCCCGGCCGAACA
GGTCGCCACCCCGGCCTTCGACGAGCGCCTGCGCAAAGTCCTGCTGCAAACCTTCCGCCCGGCGTTCCTC
GCGCGCATGACCGTGGTGCCTTACCGGCCGCTGGAGGAAGCCACCCTGGAAGGCATCGTCGTGGCCAAGC
TGGAAAAACTGCGGGAACGCTACAAGGCCGCTACCGGCAAACAGTTCGACTTCGACCCGGCCATCGTCAA
GGCCGTGCTCGCCAAGTGCAGAGCGGCGGGCGCGCGGGATATCGAGAACGTGCTGATGGCGCAGGTGACG
GGGAAGTTGGCGGAGTGGGTGTTGGAGTAG