SecReT6
Protein ID: 392984080
SecReT6 ID675
T6SS typei4a
Gene symbol-
Locus tagPADK2_13420
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]2891310..2892326 [-]
Producthypothetical protein
NoteTssG
UniProt IDI6RYK0
KEGG IDpdk:PADK2_13420
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-79, Aligned region: 18..318
Protein Sequence: 338 a.a.     [Download]
>gi|392984080|ref|YP_006482667.1| hypothetical protein PADK2_13420 [Pseudomonas aeruginosa DK2]
MATPGRLAALPLSQRLRRTPQRFELLQALLLLERERPQALPLGTGNAPRAEALRLRGPLLPLFASSEVES
LLDDPQQPVLSTPVFGLGGPDGPLPYAYQEWLQQRARQKDHAPAEFLDLFQHRLLSLLYRVLRKHRVALG
FAVPAATPVQAQLRALSGLLPKALQERLALPDSAVLARTALFAGGRRSLAGFAGLVRQHFGVEARLDAYQ
GAWKEIPAASRSRLQRGGRNLRLGRDAIAGTRTWDEHAGIALSLGPLDAREAARFFPDGDAHGQLASLAA
LYFGPDLDCRLSLLVSGGAPLRLERGAPPRLSWNTGLRRVEDSQRQRIDLDLRQPEVA
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c2892326-2891310 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGAGTCAGCGGCTGCGCCGCACGCCGCAGCGCTTCG
AACTGTTGCAGGCGCTGCTGCTGCTCGAACGCGAGCGTCCCCAGGCGTTGCCGCTGGGCACCGGCAACGC
GCCGCGGGCGGAGGCCCTGCGCCTGCGCGGGCCGCTGTTGCCGCTGTTCGCCTCGAGCGAGGTGGAAAGC
CTGCTCGACGACCCGCAGCAACCGGTGCTGTCCACCCCGGTGTTCGGCCTCGGCGGACCCGACGGCCCGT
TGCCCTATGCCTACCAGGAATGGCTGCAACAACGCGCCCGGCAGAAGGACCATGCCCCCGCCGAGTTCCT
CGACCTGTTCCAGCACCGCCTGCTCAGCCTGCTCTACCGGGTGCTGCGCAAGCATCGCGTGGCGCTCGGT
TTCGCGGTGCCGGCGGCGACCCCGGTGCAGGCGCAGCTACGCGCCCTCAGCGGCCTGTTGCCGAAAGCCC
TGCAAGAGCGCCTGGCGCTGCCGGACAGCGCGGTACTGGCACGCACCGCGCTGTTCGCCGGCGGGCGTCG
CTCCCTGGCCGGCTTCGCCGGCCTGGTGCGCCAGCATTTCGGCGTGGAGGCACGGCTGGACGCCTACCAG
GGCGCCTGGAAGGAAATCCCCGCGGCCAGCCGCAGCCGGCTGCAACGCGGCGGACGCAACCTGCGCCTGG
GTCGCGACGCCATAGCCGGCACGCGCACCTGGGACGAGCACGCCGGCATCGCCCTCAGTCTCGGTCCGCT
GGATGCCCGCGAAGCCGCCCGCTTCTTCCCCGACGGCGACGCCCATGGCCAGTTGGCCAGCCTCGCCGCG
CTGTACTTCGGCCCCGACCTGGATTGTCGCCTGAGCCTACTGGTGAGCGGCGGCGCGCCGCTGCGCCTGG
AGCGCGGTGCACCGCCCAGGCTGAGCTGGAACACCGGCCTGCGGCGCGTCGAAGACAGCCAGCGGCAGCG
CATCGATCTCGACCTGCGGCAGCCGGAGGTAGCCTGA