SecReT6
Protein ID: 392984082
SecReT6 ID675
T6SS typei4a
Gene symbol-
Locus tagPADK2_13430
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]2894067..2894492 [-]
Producthypothetical protein
NoteTssE
UniProt IDI6RLJ1
KEGG IDpdk:PADK2_13430
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.00E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|392984082|ref|YP_006482669.1| hypothetical protein PADK2_13430 [Pseudomonas aeruginosa DK2]
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPANARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGSLRSGSRLTPALFVIEQGSDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c2894492-2894067 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCGGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGAATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCGCGCGAGGTGCGGGCGGCGGTCGAGCATTTCGAGCCGCGCCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGCAATCCGCAGCGCCTGCGTATCCAGCTCGGCGGCAGCCTGCGCAGCGGGTC
GCGCCTGACGCCTGCGCTATTCGTCATCGAACAGGGCAGCGATGGCCTCGAGGTGCGCCATGAGCGATTC
GATTGA