SecReT6
Protein ID: 392984083
SecReT6 ID675
T6SS typei4a
Gene symbol-
Locus tagPADK2_13435
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]2894505..2895002 [-]
Producthypothetical protein
NoteTssD
UniProt IDI6SST7
KEGG IDpdk:PADK2_13435
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.70E-35, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|392984083|ref|YP_006482670.1| hypothetical protein PADK2_13435 [Pseudomonas aeruginosa DK2]
MDAIILDFGNDIKGDSLLVGYENKIEIMSYSHNVAMQVTNDVSNSERTSGKPHVGEFTLTKFIDTSTPTL
NEYCCAGKPIAEATITIGRNAAEGNGQIMPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELT
AQKDDGTKEGTAASTWDLAANQLVK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c2895002-2894505 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGGATGCGATCATTCTCGATTTCGGCAACGACATCAAAGGCGACAGCCTGCTCGTCGGCTACGAAAACA
AGATCGAAATCATGTCCTACAGCCACAACGTGGCGATGCAGGTCACCAACGACGTCAGCAACTCGGAGCG
CACCTCCGGCAAACCCCACGTCGGCGAATTCACCCTCACCAAGTTCATCGACACCTCGACCCCAACCCTC
AACGAGTATTGCTGCGCCGGCAAGCCGATCGCCGAGGCGACCATCACCATCGGCCGCAACGCCGCCGAGG
GCAACGGGCAGATCATGCCCTTCATCGTCTACACCCTGAACAACGTGGTGCTCTCCAACGTCAGCGTCAG
CGGCGGCGCCGGCGGCAAGCCGGTGGAGACCCTGTCGCTGAACTTCACCAAGATCAAGTGGGAGCTGACC
GCGCAGAAGGACGACGGCACCAAGGAAGGCACGGCCGCCTCGACCTGGGACCTGGCCGCCAACCAGCTGG
TCAAGTGA