SecReT6
Protein ID: 392984868
SecReT6 ID676
T6SS typei1
Gene symbol-
Locus tagPADK2_17370
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]3752297..3753628 [-]
Producthypothetical protein
NoteTssK
UniProt IDI6SUU5
KEGG IDpdk:PADK2_17370
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.60E-144, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|392984868|ref|YP_006483455.1| hypothetical protein PADK2_17370 [Pseudomonas aeruginosa DK2]
MNVHKIVWQEGMLLRPQHLQHNDRYYDNQMKARTQLLGSYNWGFLALELDRQFLNMGKLVISQASGVLPD
GSLFELGGNTEPLALDVPPNTSNVPIYLALPLVTGNHIEARRPEQAEVLARYTAYDLEVADSNAGEDSMV
QVSCARPDFRLLLGEQQSDQAYVKLKVAVVLDTTPDGVISLDPDFVPSYLHAHASAYLLSCLKEVISMLG
HRGDTIAERIRSNGKVGGAEVGDFMMLQLINRTELLLRHYLGLEQVHPEQLYRVLLTMLGDLATFGSESK
RPRLDSRYQHSDQGASFRRLMEAIRQVLSMVLEQHAIELPLQARQYGILVSPLHDHKLLGSASFVLAASA
NCESEELRQRLPAHLKVGAVEHIRQLVNLHLPGIRVKPLPVAPRQIPFHSNKTYFILEPNAEDMAQLERS
GGFAFHVSGEFSELELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c3753628-3752297 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGAACGTGCACAAGATCGTCTGGCAGGAAGGCATGCTGCTGCGCCCGCAGCACCTGCAACACAACGACC
GCTACTACGACAACCAGATGAAGGCCCGGACCCAGTTGCTGGGCAGCTACAACTGGGGCTTCCTCGCCCT
GGAGCTGGACCGCCAGTTCCTCAACATGGGCAAGCTGGTGATCAGCCAGGCCTCCGGCGTATTGCCCGAC
GGCAGCCTGTTCGAACTCGGCGGCAACACCGAGCCGCTCGCCCTCGACGTGCCGCCCAATACCTCGAACG
TGCCGATCTACCTGGCCCTGCCGCTGGTCACCGGCAACCACATCGAGGCGCGCCGGCCGGAGCAGGCCGA
GGTCCTGGCGCGCTATACCGCCTACGACCTGGAGGTGGCGGACTCCAACGCCGGCGAGGATTCCATGGTG
CAGGTCAGCTGCGCGCGGCCGGATTTTCGCCTGCTGCTCGGCGAGCAGCAGAGCGACCAGGCCTACGTCA
AACTGAAGGTGGCGGTGGTGCTGGATACCACGCCGGACGGGGTGATCAGCCTCGACCCCGACTTCGTGCC
GAGCTACCTCCACGCCCACGCATCCGCCTACCTGCTGTCCTGCCTGAAGGAGGTGATCAGCATGCTCGGC
CATCGCGGCGACACCATCGCCGAGCGTATCCGGTCCAATGGCAAGGTCGGCGGCGCGGAGGTCGGCGATT
TCATGATGCTGCAACTGATCAATCGCACCGAGTTGCTGCTGCGCCACTACCTGGGATTGGAGCAGGTGCA
TCCGGAGCAGTTGTACCGGGTGCTGCTGACCATGCTCGGCGACCTCGCCACCTTCGGCAGCGAGAGCAAG
CGTCCGCGCCTGGACAGCCGTTACCAGCACAGCGACCAGGGCGCCAGCTTCCGCAGGCTGATGGAGGCGA
TCCGCCAGGTCCTGTCGATGGTGCTCGAGCAGCATGCCATCGAACTGCCTCTCCAGGCCCGCCAGTACGG
CATCCTGGTCTCGCCCCTGCACGACCACAAGCTGCTCGGCAGCGCCTCGTTCGTGCTCGCCGCCAGTGCC
AATTGCGAGTCGGAGGAACTGCGCCAGCGGCTGCCCGCGCATCTCAAGGTGGGTGCGGTCGAGCACATTC
GCCAACTGGTCAACCTGCACCTGCCGGGGATCCGGGTCAAGCCGCTGCCGGTGGCGCCGCGGCAGATCCC
GTTCCACTCCAACAAGACCTATTTCATTCTCGAACCCAACGCCGAGGACATGGCCCAGCTGGAGCGCTCC
GGCGGTTTCGCGTTCCACGTATCCGGCGAGTTCTCCGAGCTTGAACTGAAATTCTGGGCCATCAGGAACT
GA