SecReT6
Protein ID: 392984869
SecReT6 ID676
T6SS typei1
Gene symbol-
Locus tagPADK2_17375
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]3753625..3754131 [-]
Productlipoprotein
NoteTssJ
UniProt IDI6SKX7
KEGG IDpdk:PADK2_17375
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-42, Aligned region: 19..154
Protein Sequence: 168 a.a.     [Download]
>gi|392984869|ref|YP_006483456.1| lipoprotein [Pseudomonas aeruginosa DK2]
MSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAF
ENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPVTAK
ELTRVELKLGQKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 507 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c3754131-3753625 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGTCTCGTCGCCCGATCCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGCTGGCCGGCT
GTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGAGCGGGTCAA
TCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAACACCCGGTGGCGTTC
GAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGGTGACCAGCG
AGGAGCTGGAGCTGCGTCCCGGCGAGCGGGTCGAACTCAAGCTCAGCGTGGAGGAGGGGAGCCGCTACGT
GGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTCACGGCGAAA
GAGCTGACCCGGGTAGAGCTGAAGCTGGGCCAGAAGGGCATCCTGAATGCCGGCGAATTGCTCGGCAAGG
CGGGTGACGCGCGATGA