SecReT6
Protein ID: 392984870
SecReT6 ID676
T6SS typei1
Gene symbol-
Locus tagPADK2_17380
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]3754137..3755330 [-]
Producthypothetical protein
NoteFha
UniProt IDI6S0M3
KEGG IDpdk:PADK2_17380
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.80E-14, Aligned region: 30..96
Protein Sequence: 397 a.a.     [Download]
>gi|392984870|ref|YP_006483457.1| hypothetical protein PADK2_17380 [Pseudomonas aeruginosa DK2]
MELVLEMLSAKQFVPTELCSKTFGRNGGLIGRGGECDWAIPDRKRHLSKQHARVSYRNGAFYLTDTSSNG
IRAGNGSRLPHGEPQRIEQDSVFLLGDFEIRARLLREPDELAMDVGRPQPAGSIIPDDAFLALDPLQALD
QDGADAYELDDLSAIAQPSHEAGARADYARIDMESLVVPELVPAPAAPQEPVESPPPERDEAFWQRFGQA
LGVDLEGLDGAAREALAIDAAGLLRQCIGGLQQSLRTRSELKNELRLSLSTLRDTGKNPLRFSADAGEAL
GHLLRDGKPGQLSGEQAVARSFRDLQAHQVALLGASRAAVRATLEHFSPQQLALRFERDGRRPLLATSGS
RWRAYGRYHQSLCQDDDWSERLLARDFAQAYEEQVRLISTLYTEHQG
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c3755330-3754137 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGGAACTGGTATTGGAAATGCTCAGCGCCAAGCAATTCGTACCGACGGAGCTGTGCAGCAAGACCTTCG
GCAGGAACGGCGGCCTCATCGGCCGCGGCGGTGAGTGCGATTGGGCGATTCCCGATCGCAAGCGGCACCT
GTCCAAGCAGCATGCGCGGGTCAGCTATCGCAACGGCGCGTTCTACCTGACCGACACCAGCAGCAACGGC
ATCCGCGCCGGCAACGGCAGCCGCCTGCCGCATGGCGAGCCGCAGCGCATCGAGCAGGACAGCGTCTTCC
TGCTCGGCGACTTCGAGATCCGCGCGCGGTTGCTGCGCGAGCCCGACGAGCTCGCCATGGACGTCGGGCG
GCCGCAGCCGGCGGGCAGCATCATTCCGGACGATGCTTTCCTGGCCCTCGATCCGTTGCAGGCGCTCGAC
CAGGACGGTGCAGATGCCTACGAACTCGACGACCTGAGCGCGATCGCCCAGCCCAGTCATGAGGCCGGGG
CGCGTGCGGACTACGCGCGGATCGACATGGAAAGCCTGGTCGTACCGGAGCTGGTGCCCGCCCCGGCGGC
TCCGCAGGAACCCGTGGAAAGTCCGCCTCCGGAACGCGACGAAGCCTTCTGGCAGCGTTTCGGCCAGGCG
CTCGGAGTGGACCTCGAAGGCCTCGACGGCGCTGCGCGCGAAGCGCTGGCGATCGACGCCGCCGGTTTGC
TGCGGCAGTGCATCGGCGGCTTGCAGCAGAGCCTGCGGACCCGCAGCGAACTGAAGAACGAACTGCGCCT
GTCGCTGAGCACATTGCGCGATACCGGCAAGAATCCCTTGCGCTTCAGCGCCGATGCCGGCGAGGCGCTG
GGTCATCTGCTACGGGATGGCAAGCCTGGCCAGTTGAGTGGCGAACAGGCCGTCGCACGCAGTTTCCGCG
ACCTCCAGGCGCACCAGGTGGCGCTGCTCGGCGCCAGCCGGGCGGCGGTGCGCGCGACCCTCGAGCATTT
CTCGCCGCAGCAGCTGGCCCTGCGTTTCGAGCGCGACGGTCGCCGGCCGTTGCTGGCCACCTCGGGCAGC
CGCTGGCGTGCCTATGGTCGCTACCACCAGTCGCTATGCCAGGACGACGATTGGAGCGAGCGTCTGTTGG
CGCGTGATTTCGCCCAGGCCTACGAAGAGCAGGTTCGCCTGATTTCCACCCTCTACACCGAGCACCAAGG
ATGA