SecReT6
Protein ID: 392984873
SecReT6 ID676
T6SS typei1
Gene symbol-
Locus tagPADK2_17395
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]3757099..3759726 [-]
ProductClpA/B-type protease
NoteTssH
UniProt IDI6SUU8
KEGG IDpdk:PADK2_17395
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.60E-44, Aligned region: 206..284
AAA_2 [PF07724], Evalue: 7.60E-44, Aligned region: 609..774
AAA [PF00004], Evalue: 5.20E-20, Aligned region: 208..339
AAA [PF00004], Evalue: 5.20E-20, Aligned region: 614..737
AAA_5 [PF07728], Evalue: 1.80E-13, Aligned region: 208..230
AAA_5 [PF07728], Evalue: 1.80E-13, Aligned region: 613..732
ClpB_D2-small [PF10431], Evalue: 6.20E-12, Aligned region: 430..455
ClpB_D2-small [PF10431], Evalue: 6.20E-12, Aligned region: 733..763
ClpB_D2-small [PF10431], Evalue: 6.20E-12, Aligned region: 785..854
AAA_22 [PF13401], Evalue: 6.50E-09, Aligned region: 207..294
AAA_22 [PF13401], Evalue: 6.50E-09, Aligned region: 612..718
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 9..95
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 186..230
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 584..649
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 678..707
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 761..840
AAA_17 [PF13207], Evalue: 5.50E-07, Aligned region: 208..277
AAA_17 [PF13207], Evalue: 5.50E-07, Aligned region: 612..648
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 208..235
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 613..652
Clp_N [PF02861], Evalue: 2.70E-05, Aligned region: 28..73
Clp_N [PF02861], Evalue: 2.70E-05, Aligned region: 102..122
Sigma54_activat [PF00158], Evalue: 3.00E-05, Aligned region: 203..225
Sigma54_activat [PF00158], Evalue: 3.00E-05, Aligned region: 613..732
AAA_25 [PF13481], Evalue: 8.90E-05, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 8.90E-05, Aligned region: 264..303
AAA_25 [PF13481], Evalue: 8.90E-05, Aligned region: 610..642
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 208..345
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 612..695
AAA_18 [PF13238], Evalue: 0.00028, Aligned region: 208..231
AAA_18 [PF13238], Evalue: 0.00028, Aligned region: 614..650
AAA_29 [PF13555], Evalue: 0.00036, Aligned region: 201..225
AAA_29 [PF13555], Evalue: 0.00036, Aligned region: 611..638
AAA_19 [PF13245], Evalue: 0.00079, Aligned region: 205..233
AAA_19 [PF13245], Evalue: 0.00079, Aligned region: 353..384
AAA_19 [PF13245], Evalue: 0.00079, Aligned region: 480..509
AAA_19 [PF13245], Evalue: 0.00079, Aligned region: 611..635
DUF258 [PF03193], Evalue: 0.00081, Aligned region: 174..227
DUF258 [PF03193], Evalue: 0.00081, Aligned region: 612..625
IstB_IS21 [PF01695], Evalue: 0.00084, Aligned region: 202..227
IstB_IS21 [PF01695], Evalue: 0.00084, Aligned region: 455..482
IstB_IS21 [PF01695], Evalue: 0.00084, Aligned region: 613..631
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 208..234
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 256..288
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 613..648
Zeta_toxin [PF06414], Evalue: 0.0059, Aligned region: 206..229
Zeta_toxin [PF06414], Evalue: 0.0059, Aligned region: 612..653
Protein Sequence: 875 a.a.     [Download]
>gi|392984873|ref|YP_006483460.1| ClpA/B-type protease [Pseudomonas aeruginosa DK2]
MINVDLQQLIQALDADTRRDLEGSAERCVARGGSKVLVEDLLLGLLERPQGLLARALQDAAVDAGELNAA
LQARGEHSASRNPVFAPELVQWLQDALLLANLELGRSQIDQAALILALLRNPLRYAGSRYQPLLARLDIE
RLKDFALSQPLEGAPSGKPGGGESLLQRFTHNLTQQARDGKLDPVLCRDGAIRQMVDILARRRKNNPIVV
GEAGVGKTAIVEGLASRIAAGEVPPALRDVELLSLDMGLLQAGASVKGEFERRLKGVIDEVKAALRPTIL
FIDEAHTLIGAGGQAGGSDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPSVAE
AVTILRGLARVYEESHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPESLERL
RGELAEGERQRQALRRDAEAGLPIDHDALQALEERLAQVESERHVQEDQWSRQRELAERLLALRQQLARA
REANREEQGGEADAETFPADEHGGVEALEKALHETRQALADAQAQGRLVSFEVCPRLVAEVIGAWTGVPV
EQLAREHNAKVMGFADDLRARIRGQEQAVSALDRAMRATAAGLNKPDAPVGVFLLVGPSGVGKTETALAL
ADLLYGGERFITTINMSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPDVLN
LFYQIFDKGVANDGEGREIDFRNTLILMTSNLASEHIAALCQDGARPSAELLEETIRPALSRHFKPALLA
RMRVVPYYPVGGPVLRELIEIKLQRLGERLARRQLAFDYSQALVGHLAERCTQSDSGARLIDHLLDTHLL
PLVADRLLEAMARDERLERVHATLGEHGRVLCEFA
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c3759726-3757099 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGATCAACGTAGACCTGCAACAACTGATTCAGGCGCTGGATGCCGACACCCGGCGCGACCTCGAAGGCT
CGGCCGAGCGCTGCGTAGCCCGTGGCGGCAGCAAGGTACTGGTGGAGGACCTGTTGCTGGGCCTGCTGGA
GCGTCCCCAGGGACTGCTGGCGCGCGCCCTGCAGGATGCCGCGGTGGACGCCGGCGAACTCAACGCCGCG
TTGCAAGCGCGGGGCGAGCATAGTGCCTCGCGCAATCCGGTGTTCGCGCCCGAGCTGGTGCAGTGGCTGC
AGGATGCGCTGTTGCTGGCCAACCTCGAACTGGGCCGTAGCCAGATCGACCAGGCGGCATTGATCCTGGC
CCTGCTACGCAACCCGTTGCGCTATGCCGGCAGCCGCTACCAGCCGCTGCTGGCGCGGCTCGACATCGAG
CGGTTGAAGGATTTCGCGCTCTCGCAGCCGCTGGAGGGCGCGCCCAGCGGCAAGCCGGGCGGCGGCGAGT
CCCTGTTGCAGCGTTTCACCCACAACCTTACCCAGCAGGCGCGCGACGGCAAGCTCGATCCGGTGCTCTG
TCGCGACGGGGCTATTCGCCAGATGGTCGACATCCTGGCCCGTCGGCGGAAAAACAACCCCATCGTGGTC
GGCGAGGCCGGCGTCGGCAAGACCGCCATCGTCGAAGGCCTGGCCTCGCGGATCGCCGCAGGGGAAGTGC
CGCCGGCGCTGAGGGACGTCGAGCTGTTGTCCCTCGACATGGGCCTGTTGCAGGCCGGTGCCAGCGTGAA
GGGCGAGTTCGAGCGGCGCCTGAAAGGCGTCATCGACGAAGTGAAGGCAGCGCTCAGGCCGACCATCCTG
TTCATCGACGAGGCCCATACGCTGATCGGCGCGGGCGGTCAGGCCGGCGGCTCGGATGCCGCCAACCTGC
TCAAGCCGGCCCTGGCACGTGGCGAGTTGCGCACCATCGCGGCGACGACCTGGGCCGAATACAAGAAGTA
TTTCGAGAAGGACCCGGCGCTGGCCCGGCGCTTCCAGCCCGTGCAGTTGCATGAGCCGAGCGTTGCCGAG
GCGGTGACGATCCTGCGTGGCCTGGCCCGGGTTTACGAGGAAAGCCACGGTATCTACCTGCGCGACGACG
CGGTGGTGGCCGCCGCCGAACTGTCCGCCCGCTACCTGGCGGGTCGCCAGTTGCCGGACAAGGCCGTCGA
CGTCCTCGACACCGCCTGTGCCCGGGTGCGCATCAGCCTGGCGGCGGCGCCGGAGAGTCTCGAGCGCCTG
CGCGGCGAGCTGGCCGAAGGCGAGCGCCAGCGCCAGGCCCTGCGCCGCGATGCCGAGGCAGGCCTGCCGA
TCGACCACGATGCCCTGCAGGCGCTGGAGGAGCGCCTGGCCCAGGTGGAAAGCGAGCGGCACGTACAGGA
GGACCAGTGGAGCCGCCAGCGCGAACTCGCCGAGCGCCTGCTCGCCCTGCGCCAGCAATTGGCCAGGGCC
CGCGAGGCGAACCGGGAAGAGCAGGGCGGCGAGGCGGACGCGGAGACTTTCCCGGCCGACGAGCATGGCG
GTGTCGAAGCCCTGGAAAAGGCCCTTCACGAAACCCGCCAGGCGCTCGCCGATGCCCAGGCCCAGGGGCG
GCTGGTCAGCTTCGAGGTCTGCCCGCGCCTGGTTGCCGAGGTGATCGGCGCCTGGACCGGCGTACCGGTG
GAACAACTGGCGCGGGAACACAACGCCAAGGTGATGGGGTTCGCTGACGACCTGCGGGCGCGGATCCGTG
GCCAGGAACAGGCGGTCAGCGCCCTGGACCGCGCGATGCGCGCCACCGCGGCTGGGCTGAACAAGCCCGA
TGCGCCGGTCGGCGTGTTCCTGCTGGTGGGCCCGAGCGGGGTGGGCAAGACCGAGACCGCGCTGGCGCTG
GCCGACCTGCTGTATGGCGGCGAGCGTTTCATCACCACCATCAACATGTCCGAGTTCCAGGAGAAGCACA
CCGTCTCGCGCCTGATCGGCGCGCCGCCCGGCTATGTCGGCTATGGCGAGGGTGGCATGCTCACCGAGGC
GGTACGCCAGAAGCCCTATTCGGTGATATTGCTGGACGAGGTGGAGAAGGCCGATCCGGACGTGCTCAAC
CTGTTCTACCAGATCTTCGACAAGGGCGTGGCCAACGATGGCGAAGGGCGCGAGATCGATTTCCGCAATA
CCTTGATCCTGATGACCTCCAACCTCGCCAGCGAGCACATCGCCGCGCTTTGCCAGGACGGCGCGCGGCC
TTCCGCCGAACTCCTGGAGGAAACCATCCGGCCGGCGCTCAGCCGGCATTTCAAGCCGGCGCTGCTGGCG
CGCATGCGCGTGGTGCCTTACTACCCGGTGGGCGGCCCGGTACTGCGCGAGCTGATCGAGATCAAGCTGC
AACGCCTCGGCGAGCGCCTGGCGCGCCGTCAACTGGCTTTCGACTACAGCCAGGCGCTGGTGGGCCACCT
GGCCGAGCGTTGCACCCAGAGCGACAGCGGCGCACGGTTGATCGACCACCTGCTGGACACGCACCTGCTG
CCGCTGGTGGCCGACCGTTTGCTGGAAGCGATGGCGCGCGACGAGCGTCTCGAGCGGGTCCATGCGACGC
TGGGCGAGCACGGCCGCGTGCTCTGCGAGTTCGCCTGA