SecReT6
Protein ID: 392984877
SecReT6 ID676
T6SS typei1
Gene symbol-
Locus tagPADK2_17415
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]3763255..3764730 [-]
Producthypothetical protein
NoteTssC
UniProt IDI6RNL3
KEGG IDpdk:PADK2_17415
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-192, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|392984877|ref|YP_006483464.1| hypothetical protein PADK2_17415 [Pseudomonas aeruginosa DK2]
MSTSAAQQGRNQNGEYNILDSIIAETRLSPDDEAYDIAKRGVSAFIEELLKPQNDGEPVKKAMVDRMIAE
IDAKLSTQMDEILHHPDFQALESAWRGLQLLVDRTNFRENIKIEILSVSKQDLLDDFEDSPEVMQSGLYK
HIYTAEYGQFGGQPVGAIIANYYMSPSSPDVKLMQYVSSVACMAHAPFVAAAGPKFFGLESFTGLPDLKD
LKDHFEGPQFAKWQSFRQSEDSRYVALTVPRFLLRTPYDPEENPVKSFAYKETVANSHEHYLWGNTAYAF
GTKLTDSFAKYRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFISLTMRK
GSDNAAFFSASSVQKPKFFGISAEGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLEL
ELNKWIRQYVADQENPSAEVRGRRPLRAAQIIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c3764730-3763255 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGAGCACCAGTGCCGCACAGCAAGGCCGGAACCAGAACGGCGAATACAACATTCTCGACAGCATCATCG
CCGAGACCCGCCTGAGCCCGGACGACGAGGCCTACGACATCGCCAAGCGCGGCGTCTCCGCCTTCATCGA
GGAATTGCTCAAGCCGCAGAACGACGGCGAGCCGGTGAAGAAGGCGATGGTCGACCGGATGATCGCCGAG
ATCGACGCCAAGCTCAGCACGCAGATGGACGAGATCCTCCATCATCCCGATTTCCAGGCGCTGGAGTCGG
CCTGGCGCGGCCTGCAACTGCTGGTCGACCGCACCAACTTCCGCGAGAACATCAAGATCGAGATTCTCAG
CGTTTCCAAGCAGGACCTGCTGGACGATTTCGAGGACTCGCCCGAGGTGATGCAGTCCGGCCTGTACAAG
CACATCTACACCGCCGAATACGGCCAGTTCGGTGGCCAGCCGGTCGGCGCCATCATCGCCAACTACTACA
TGTCGCCCAGTTCGCCCGACGTCAAGCTGATGCAATACGTCTCCAGCGTGGCCTGCATGGCCCATGCGCC
ATTCGTGGCGGCCGCCGGTCCGAAGTTCTTCGGCCTGGAAAGCTTCACCGGCCTGCCGGACCTGAAGGAC
CTGAAGGATCATTTCGAAGGCCCGCAGTTCGCCAAGTGGCAGAGCTTCCGCCAGTCCGAGGATTCCCGCT
ACGTGGCGCTGACCGTACCGCGCTTCCTGCTGCGCACGCCCTACGATCCGGAAGAGAATCCGGTCAAGTC
GTTCGCCTACAAGGAGACCGTGGCCAACAGCCACGAGCATTACCTGTGGGGCAACACCGCCTATGCCTTC
GGCACCAAGCTGACCGACAGCTTCGCCAAGTATCGCTGGTGCCCGAACATCATCGGGCCGCAGAGCGGCG
GTGCGGTAGAGGACCTGCCGTTGCACCACTTCGAGAGCATGGGCGAGATCGAGACCAAGATCCCCACCGA
GGTGCTGGTGTCCGATCGCCGCGAGTACGAACTGGCCGAGGAAGGCTTCATTTCCCTGACCATGCGCAAG
GGCAGCGACAACGCCGCGTTCTTCTCCGCCAGCTCGGTGCAGAAGCCGAAGTTCTTCGGCATCAGCGCCG
AAGGCAAGGCCGCGGAGCTGAACTACAAGCTCGGCACCCAGTTGCCGTACATGATGATCGTCAACCGCCT
GGCCCATTACCTGAAGGTCCTGCAACGCGAACAGCTGGGGTCGTGGAAGGAGCGTACCGACCTCGAGCTG
GAGCTGAACAAGTGGATCCGCCAGTACGTCGCCGACCAGGAAAACCCCAGCGCCGAAGTGCGCGGCCGTC
GCCCGCTGCGCGCTGCACAGATCATCGTCAGTGACGTCGAGGGCGAGCCGGGCTGGTACCGCGTCAGCCT
GAACGTGCGCCCCCACTTCAAGTACATGGGGGCGGACTTCACCCTGTCGCTGGTCGGCAAGCTGGACAAA
GAGTAA