SecReT6
Protein ID: 392984878
SecReT6 ID676
T6SS typei1
Gene symbol-
Locus tagPADK2_17420
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]3764759..3765265 [-]
Producthypothetical protein
NoteTssB
UniProt IDI6SUV4
KEGG IDpdk:PADK2_17420
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.40E-54, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|392984878|ref|YP_006483465.1| hypothetical protein PADK2_17420 [Pseudomonas aeruginosa DK2] [TssB]
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRADERKVEDRKPIGIDKMTFDEVLAKQE
LGLTLSVPNRLQEEGGSDELAVGLQINSMKDFNPASIVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLADDESRSRVLGELGLSAAPSQDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c3765265-3764759 Pseudomonas aeruginosa DK2, complete sequence [TssB]
ATGGCCAAAGAAGGCTCGGTAGCCCCAAAGGAACGCATCAACGTCACCTTCAAGCCCGCCACTGGCGGTG
CCCAGGAAGAAATCGAACTGCCGTTGAAGCTACTGGCGATCGGCGATTACACCCAGCGCGCGGATGAGCG
CAAGGTGGAGGACCGCAAGCCGATCGGCATCGACAAGATGACCTTCGACGAGGTTCTGGCCAAGCAGGAG
CTGGGGCTGACGCTGAGCGTACCCAATCGTCTCCAGGAGGAGGGCGGCAGCGACGAGCTGGCGGTGGGGC
TGCAGATCAACTCGATGAAGGACTTCAACCCGGCCAGCATCGTCGAGCAGGTGCCCGAGCTGAAGAAGCT
GATGGAGTTGCGCGATGCGCTGGTGGCCCTCAAGGGCCCGCTGGGCAACGCCCCGGCGTTCCGCAAGGCC
ATCGAAAGCGTACTCGCCGACGACGAGTCCCGTAGCCGTGTGCTGGGCGAGCTGGGGCTGAGCGCCGCCC
CCTCCCAGGACGCCTGA