SecReT6
Protein ID: 395443794
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00294
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]150200..151321 [-]
ProductATPase
NoteTssH
UniProt IDI3UN61
KEGG IDppi:YSA_00294
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.90E-35, Aligned region: 87..268
ClpB_D2-small [PF10431], Evalue: 7.60E-18, Aligned region: 277..348
AAA_5 [PF07728], Evalue: 4.20E-10, Aligned region: 93..218
AAA [PF00004], Evalue: 5.70E-10, Aligned region: 93..223
AAA [PF00004], Evalue: 5.70E-10, Aligned region: 269..292
Sigma54_activat [PF00158], Evalue: 1.70E-08, Aligned region: 90..225
Sigma54_activat [PF00158], Evalue: 1.70E-08, Aligned region: 244..289
AAA_16 [PF13191], Evalue: 4.30E-06, Aligned region: 62..187
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 96..136
AAA_22 [PF13401], Evalue: 0.00096, Aligned region: 93..190
AAA_33 [PF13671], Evalue: 0.0018, Aligned region: 93..208
Protein Sequence: 373 a.a.     [Download]
>gi|395443794|ref|YP_006384047.1| ATPase [Pseudomonas putida ND6]
MPFLNDLLEQTRRDASSSAALSAENCHTRAIVETHLRSEDTLQSRFRFDVAAVMQVVRNEVLGQDEALQA
IEDVLTVVRADILDPRRPLFTALFLGPTGVGKTEVVRALARALHGDADAFCRVDMNTLAQEHYAAALTGA
PPGYAGAKEGRTLFDQALLDGSQGRPGIVLFDELEKASKEVSQALLNVFDNGLLRLASGEKSFNFRNTLV
FMTSNLAADEIRQHRLGLLAPLRRLLGLQAGRRERLLGLVRRRLVKRFSAEFVNRIDSTVVFNAIEQEVS
ERIVELEVSRLNRRLAKHHCHLQLDAAVVGKLASEGHDLEFGARALKRFIRHELEVPLAEYLLGNRIPCQ
ADVTCMTVAGHLERGRIRFSLPT
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c151321-150200 Pseudomonas putida ND6 chromosome, complete genome
ATGCCGTTCTTGAACGACCTGCTGGAGCAGACGCGTCGCGATGCGTCCTCCAGTGCTGCACTGAGTGCCG
AAAACTGCCACACCCGGGCAATCGTCGAGACCCACCTGCGCAGCGAAGACACCCTGCAGTCGCGTTTCCG
CTTCGATGTCGCTGCCGTCATGCAGGTAGTACGCAACGAAGTGCTGGGCCAGGACGAAGCCTTGCAGGCC
ATCGAAGATGTGCTCACGGTGGTGCGTGCGGATATTCTCGACCCGCGCCGCCCGCTGTTCACGGCATTGT
TCCTCGGCCCGACCGGGGTCGGCAAGACCGAGGTCGTGCGTGCCCTGGCCCGCGCCCTGCACGGTGATGC
CGATGCCTTCTGCCGGGTCGACATGAACACGCTGGCCCAGGAACACTACGCCGCTGCTCTGACCGGCGCG
CCACCGGGCTATGCTGGCGCCAAGGAAGGCCGCACGCTGTTTGATCAGGCGCTGCTGGACGGGAGCCAAG
GGCGCCCTGGGATCGTGCTGTTCGATGAGCTGGAAAAGGCCAGCAAGGAGGTGTCCCAGGCGCTGCTCAA
TGTGTTCGACAATGGCCTGCTGCGCTTGGCCTCCGGTGAAAAGAGCTTCAATTTCCGTAACACACTGGTG
TTCATGACCAGCAACCTGGCGGCAGACGAAATACGCCAGCACCGGCTGGGCCTGTTGGCGCCGCTGCGGC
GTCTGCTTGGCCTGCAGGCAGGGCGACGCGAGCGTTTGCTGGGGCTGGTGCGGCGGCGCCTGGTGAAGCG
TTTTTCTGCCGAGTTCGTCAACCGCATCGACAGCACTGTGGTGTTCAATGCCATCGAACAGGAGGTGAGC
GAGCGCATCGTTGAACTGGAGGTGTCGCGCCTGAACCGGCGCCTTGCCAAGCATCACTGCCACCTGCAGC
TGGATGCGGCGGTGGTTGGCAAGCTGGCCAGCGAAGGCCACGACCTGGAGTTTGGCGCGCGTGCGCTCAA
GCGCTTTATCCGCCATGAGCTGGAAGTGCCACTGGCCGAGTACCTGCTTGGTAACCGCATCCCATGCCAG
GCAGACGTGACGTGCATGACGGTGGCCGGCCACCTTGAGCGCGGGCGCATCCGTTTTTCGTTGCCGACAT
GA