SecReT6
Protein ID: 395443812
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00323
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]173384..174841 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDI3UN79
KEGG IDppi:YSA_00323
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-18, Aligned region: 52..112
Protein Sequence: 485 a.a.     [Download]
>gi|395443812|ref|YP_006384065.1| ImpA domain-containing protein [Pseudomonas putida ND6]
MVAQVSGEEVTRLLAPIDPAVPAGLFDVEDETYQAIDQEMVKLGGLQEASIDWVYIEDASRQYLSQQCKH
LRIVAHLSTAWLRSGCWEQWGCTLALLAGMLECYWEAAHPKPGPKGFLGKRKLVALVIDRLAEALPRLDR
FTYTPTHAAAAQAALKRLQQQETVQLDTAALGELERLLGKYSELANGVGEAAVPKAPAATEKPAPLADVI
ATPVSRMSMGNERETRRAVLSMAELINQQDPYDATGYQLRRFGLWAHIQVAPQVRQGNRTELMAVPLDIT
RVYDEAIASKAVDPALLQRIEKSLTACPFWIRGSFLAATVATQLAMCEVAEAIRCATARFVQRMPSLQQL
CFSDGLVFVDDQCLAWLKGTQGPSGQGATPQEFSGLREELVSQLETGGVEPLLLRLQGLQAGFRAPRERC
HTTVIAADLLAARGVSWLAQDLCANVARTMQQTTASAWEPEVFQRLQQYAASPVLAVQDKDQEPR
 
Nucleotide Sequence: 1458 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c174841-173384 Pseudomonas putida ND6 chromosome, complete genome
GTGGTAGCGCAGGTATCCGGGGAAGAGGTCACTCGGTTGCTCGCGCCGATTGATCCGGCAGTTCCGGCTG
GCCTGTTCGATGTCGAGGACGAAACCTATCAGGCCATTGATCAGGAGATGGTCAAGCTGGGTGGGCTGCA
GGAAGCCTCGATCGACTGGGTCTACATCGAAGACGCGTCCCGTCAGTACCTGAGCCAGCAATGCAAGCAC
TTGCGAATTGTTGCGCACCTGAGTACCGCATGGTTGCGTAGCGGCTGCTGGGAGCAGTGGGGATGCACCT
TGGCGTTGCTGGCCGGCATGCTCGAGTGCTATTGGGAAGCCGCTCATCCCAAGCCGGGACCGAAAGGCTT
CCTGGGCAAGCGCAAGCTGGTTGCCCTGGTGATCGATCGCTTGGCCGAGGCGCTCCCTCGTCTTGATCGT
TTTACCTACACCCCGACCCACGCAGCGGCAGCGCAGGCTGCCTTGAAACGCCTGCAGCAACAGGAAACAG
TGCAGCTGGACACGGCAGCACTGGGCGAACTTGAGCGCCTGCTAGGCAAGTACTCGGAACTTGCCAACGG
TGTTGGCGAGGCTGCTGTGCCCAAAGCGCCGGCTGCAACCGAGAAGCCTGCGCCGTTGGCCGATGTCATC
GCCACACCCGTGTCACGCATGTCGATGGGCAATGAGCGTGAGACACGGCGGGCCGTGCTGTCCATGGCCG
AGCTCATCAACCAGCAGGACCCTTACGACGCTACCGGCTATCAGTTACGGCGTTTCGGTTTGTGGGCGCA
CATTCAGGTTGCTCCCCAAGTCAGGCAGGGCAACCGTACGGAATTGATGGCGGTGCCGCTGGATATCACG
CGGGTCTATGACGAGGCCATTGCCAGTAAGGCGGTTGACCCCGCCTTGCTGCAGCGTATTGAAAAGAGCC
TGACGGCTTGCCCCTTCTGGATTCGTGGCAGCTTTCTGGCTGCGACCGTCGCCACACAGCTGGCGATGTG
CGAGGTGGCCGAAGCCATCCGCTGTGCCACCGCCCGGTTTGTACAGCGCATGCCGTCGCTGCAGCAGTTG
TGCTTCAGCGACGGGCTGGTATTTGTCGACGATCAGTGCCTGGCCTGGCTCAAGGGCACGCAAGGGCCGT
CTGGGCAAGGTGCAACCCCCCAGGAGTTCAGCGGCCTGCGCGAGGAGTTGGTCAGCCAGTTGGAAACCGG
TGGCGTAGAACCGCTGCTCCTTCGGCTGCAAGGGCTGCAAGCGGGCTTTCGTGCTCCCCGTGAGCGCTGC
CACACCACCGTGATTGCAGCTGATCTGCTGGCCGCGCGGGGTGTGTCCTGGCTGGCCCAGGACCTGTGCG
CCAACGTTGCCCGAACCATGCAGCAAACCACCGCCAGTGCGTGGGAGCCCGAGGTGTTTCAGCGGCTTCA
GCAGTACGCGGCATCCCCAGTGTTGGCAGTTCAAGACAAGGATCAGGAGCCTCGATGA