SecReT6
Protein ID: 395443815
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00327
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]175812..176315 [+]
Producthypothetical protein
NoteTssB
UniProt IDI3UN82
KEGG IDppi:YSA_00327
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.70E-54, Aligned region: 6..158
Protein Sequence: 167 a.a.     [Download]
>gi|395443815|ref|YP_006384068.1| hypothetical protein YSA_00327 [Pseudomonas putida ND6]
MSKNTGSVAPKERVNIKYVPATSDEQAEVELPHKMLVLGDFGLDDNRALEDRQVMRIDKHTFNSVLNDAN
VSLDVTVPSRLGTAPDTELAVRLQFRSINDFGPDRIARQVPELNKLLALREALVALKGPLGNVPAFRKQL
QHLLNNEQARKQLAQELDLVLEAPEQD
 
Nucleotide Sequence: 504 bp     [Download]
>gi|395443650|ref|NC_017986.1|:175812-176315 Pseudomonas putida ND6 chromosome, complete genome
ATGTCTAAAAATACGGGATCCGTTGCGCCGAAAGAACGCGTCAATATCAAGTATGTCCCCGCTACCAGCG
ATGAGCAGGCTGAGGTGGAGCTGCCGCACAAGATGCTGGTGCTGGGCGACTTCGGCCTGGATGACAACCG
TGCGCTTGAGGACCGTCAGGTCATGCGCATCGATAAACATACATTCAACAGCGTGTTGAACGACGCCAAC
GTAAGCCTGGACGTGACGGTACCGTCCAGGCTCGGCACCGCCCCGGATACCGAGCTGGCCGTCCGCCTGC
AGTTCAGGTCCATCAACGATTTCGGGCCGGACCGGATCGCGCGCCAGGTGCCCGAGCTGAACAAGCTGCT
GGCGCTGCGCGAAGCACTGGTCGCCCTGAAAGGCCCGCTGGGTAACGTCCCGGCCTTCCGCAAGCAATTG
CAGCACCTGCTTAACAACGAGCAGGCGCGTAAGCAGCTCGCCCAAGAACTGGACCTGGTGCTCGAGGCGC
CAGAACAAGATTGA