SecReT6
Protein ID: 395443816
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00331
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]176333..177823 [+]
Producthypothetical protein
NoteTssC
UniProt IDI3UN83
KEGG IDppi:YSA_00331
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-185, Aligned region: 70..494
Protein Sequence: 496 a.a.     [Download]
>gi|395443816|ref|YP_006384069.1| hypothetical protein YSA_00331 [Pseudomonas putida ND6]
MPKPSSTAITTDATADTLSNATLLDQIMAETKLVPAQEGYQIARQGVSAFITEILKSNDPDQLINKHRAD
QMIAEIDRMLGNQMDAILHQPEFQQLESSWRSLKLLVDRTDFRENIKLEVLHVSKEDLLDDFENAADITC
SGIYKHVYTAGYGQFGGEPVAAMVGNYNFGPSSPDIKLLSYMASVGAMSHAPFLAAPAPEFFNLNSFEEL
PNLKEIKDLFAGPRHAKWRAFRESEDARHVALTGPRFMLRSAYHPQEQPIESFNYNEDIAGQHDNYLWGN
SAFLLASCINDSFARYRWCPNIIGPQSGGAVEDLPVHLYESLGQLQAKIPTEVLISDRKEFELAEEGFIA
LTMRKDSDNAAFFSANSVQKPKHFPKTPEGLQAQTNYKLGTQLPYLFIVNRLAHYIKVLQREQIGSWKER
RDLESELNKWIKQYVADQENPSADVRSRRPLRAARIEVSDVAGDPGWYQVSLAVRPHFKYMGANFEISLV
GRLDTQ
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|395443650|ref|NC_017986.1|:176333-177823 Pseudomonas putida ND6 chromosome, complete genome
ATGCCCAAGCCAAGCAGCACCGCCATCACCACAGACGCAACGGCCGACACATTGAGCAATGCCACCCTGC
TCGACCAGATCATGGCAGAAACCAAACTGGTACCTGCCCAAGAGGGCTACCAGATTGCCAGGCAGGGCGT
ATCTGCCTTCATCACCGAAATACTCAAAAGCAATGACCCAGATCAACTGATCAACAAGCACCGAGCCGAC
CAGATGATTGCCGAGATCGACCGAATGCTCGGCAATCAGATGGATGCCATTCTGCATCAGCCTGAGTTCC
AGCAGCTTGAATCATCATGGCGCAGCCTTAAACTTCTGGTGGACCGCACGGACTTCAGGGAGAACATCAA
GCTTGAAGTCTTGCATGTCAGTAAAGAGGACCTGCTCGACGACTTCGAAAATGCTGCTGACATTACCTGC
AGCGGTATCTACAAGCATGTTTACACCGCGGGTTATGGCCAATTCGGGGGAGAGCCGGTTGCGGCCATGG
TAGGCAACTACAACTTCGGCCCCTCTTCCCCTGACATCAAGTTGCTAAGTTACATGGCCTCCGTTGGCGC
CATGTCCCATGCCCCTTTTCTTGCTGCACCTGCCCCCGAATTCTTCAATTTGAACAGCTTCGAGGAGCTG
CCTAACCTCAAGGAAATAAAAGACCTCTTCGCCGGCCCTCGGCATGCCAAGTGGCGCGCTTTTCGTGAAA
GCGAAGACGCCCGCCACGTCGCCCTGACCGGGCCGCGCTTCATGCTTCGCTCCGCTTACCACCCGCAGGA
ACAACCGATCGAGAGCTTCAACTACAACGAAGACATCGCCGGGCAGCACGACAACTACCTGTGGGGCAAT
TCTGCTTTTCTGTTAGCCAGTTGCATCAACGACAGCTTCGCCCGCTACCGCTGGTGCCCGAACATCATCG
GCCCCCAATCCGGCGGTGCTGTCGAAGACTTGCCGGTCCACCTGTACGAATCCCTGGGCCAGTTGCAGGC
CAAGATTCCTACCGAGGTGCTGATATCCGACCGCAAGGAATTCGAACTGGCCGAAGAGGGCTTCATCGCC
CTGACCATGCGCAAAGACAGCGACAACGCCGCGTTCTTCTCCGCCAACTCGGTACAAAAGCCCAAGCACT
TCCCGAAAACCCCCGAGGGGCTTCAGGCACAGACCAACTACAAGCTGGGTACCCAGTTGCCCTACCTGTT
CATCGTCAACCGGCTCGCCCACTACATCAAGGTGCTGCAGCGCGAGCAGATCGGCAGTTGGAAAGAGCGC
CGTGACCTTGAGTCCGAGCTGAACAAATGGATCAAGCAGTACGTCGCCGACCAGGAGAACCCGTCTGCCG
ACGTTCGCAGCCGCCGGCCGCTGCGTGCCGCCCGTATTGAGGTCTCGGATGTTGCGGGTGACCCAGGCTG
GTACCAGGTTTCGCTCGCCGTACGTCCGCACTTCAAGTACATGGGCGCGAACTTCGAGATTTCCCTGGTC
GGGCGGCTCGATACGCAATGA