SecReT6
Protein ID: 395443818
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00335
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]178234..180000 [+]
Producthypothetical protein
NoteTssF
UniProt IDI3UN85
KEGG IDppi:YSA_00335
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-190, Aligned region: 4..588
Protein Sequence: 588 a.a.     [Download]
>gi|395443818|ref|YP_006384071.1| hypothetical protein YSA_00335 [Pseudomonas putida ND6]
MSLRDRFSEELRYLHELGNDFAKDNPQLARLLGKGASDPDVERLMEAFAFLTAKLRLKLEDDLPELTHPM
LQLLWPNYLRPLPSATIIKFSPVRQSLSQSQRIPKGSRLFSKPVDGVACEFRTCTAVNIHPFEIDTVAAT
QTSDSSVICIGLQSLVERPLNSLGCTGLDFYLSGDARTARTLYLWVSQYLKHVSVTINGEVRRLPANSIA
FPGFSPNDALLPYPQNVFDGYRILQEYFAFPQRFHFFSVTGLEKIWPAHGSQQVNLEFHFTRQLPDSLRV
GKADFNLFCAPAVNLFQHSAEPIDLSGKDAMVPLKPKGTAPHGYEIFSVDQVISTRTTTDGNTGEHLRTF
RPFESFAHEIEHVQGRTALYYRCQLEECLHGNGVMHRIAFVRADANSYIGELETASIDLTCTNRDLPLAL
GIDDINVLTELTPPLATYTNLCTPTRPCRPVLDGQLQWALISNMSLNYLSLLSVEPLKAVIRAYDFMALH
DIQQARTTRKRLEGMRDIHTQPMDWLIKGQPIRGLHTRLKLDQTAFLCEGDLYLFSCVLAHFFALYASIN
SFHHLEVINTTNNEHYTWPIQTGKQPLI
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|395443650|ref|NC_017986.1|:178234-180000 Pseudomonas putida ND6 chromosome, complete genome
ATGTCACTGAGAGACCGTTTCAGCGAAGAACTGCGTTACCTGCACGAACTGGGGAACGACTTTGCCAAGG
ACAACCCACAACTCGCGCGGTTGCTTGGCAAAGGTGCCAGCGACCCCGATGTCGAACGCCTGATGGAAGC
CTTTGCGTTCCTGACCGCCAAGCTACGGCTGAAGCTGGAAGACGACTTGCCAGAGCTGACCCATCCCATG
CTGCAGTTGCTCTGGCCGAACTACCTACGGCCGCTGCCCAGCGCGACGATCATCAAGTTCAGCCCGGTGA
GGCAATCCCTCAGCCAGTCACAGCGCATCCCAAAGGGGTCGCGACTGTTCTCGAAACCGGTAGACGGCGT
GGCCTGCGAGTTCCGCACCTGTACAGCGGTCAACATTCATCCGTTCGAGATCGACACGGTGGCAGCCACT
CAGACATCCGACAGTTCTGTGATCTGCATCGGCCTTCAATCACTGGTCGAGCGGCCGTTGAACAGCCTGG
GCTGTACCGGCCTCGACTTTTACCTCAGCGGCGATGCCCGAACCGCTCGCACGCTTTACCTGTGGGTTTC
TCAATACCTCAAGCATGTCAGCGTGACCATCAATGGCGAGGTTCGTCGGCTGCCGGCAAACAGCATCGCA
TTCCCAGGGTTCAGCCCCAACGACGCCTTGCTGCCTTATCCACAGAACGTCTTTGATGGCTACCGCATCC
TGCAGGAATACTTCGCGTTCCCTCAACGTTTTCACTTTTTCAGCGTTACCGGGCTGGAAAAAATCTGGCC
AGCTCATGGCAGCCAGCAGGTAAACCTCGAATTTCACTTCACGCGCCAGCTACCCGACTCGCTGCGTGTC
GGCAAAGCAGATTTCAACCTGTTCTGCGCACCTGCGGTCAACCTGTTCCAGCACAGCGCCGAGCCCATCG
ACCTGTCCGGCAAGGACGCCATGGTTCCACTGAAGCCCAAGGGCACAGCGCCGCACGGCTACGAAATCTT
CAGTGTCGACCAGGTGATCAGCACCCGAACGACGACTGACGGGAACACCGGTGAGCACCTTCGGACCTTC
CGTCCCTTCGAGTCATTCGCCCATGAAATCGAGCACGTCCAGGGGCGCACGGCGCTGTATTACCGCTGCC
AGCTGGAAGAGTGCCTGCACGGCAATGGCGTCATGCATCGAATCGCCTTCGTCCGCGCCGACGCCAACAG
CTACATAGGCGAGCTGGAAACCGCGTCCATCGACCTCACCTGCACCAATCGGGACCTTCCGCTGGCGCTG
GGCATTGATGACATCAACGTTCTGACCGAACTTACGCCGCCTCTGGCCACCTACACCAATCTCTGTACAC
CCACCCGCCCCTGTCGCCCGGTGCTGGACGGCCAGTTGCAGTGGGCATTGATCTCCAACATGTCGCTCAA
CTACCTGTCCTTGCTCTCGGTCGAGCCGCTGAAAGCGGTGATCCGCGCCTACGACTTCATGGCCCTGCAC
GACATCCAGCAGGCCCGCACCACCCGTAAACGCCTGGAAGGTATGCGCGACATTCATACGCAGCCCATGG
ATTGGCTGATCAAGGGGCAACCCATTCGCGGCCTGCACACCCGGCTGAAACTGGACCAGACCGCCTTCCT
CTGCGAAGGCGACTTGTACCTGTTCAGCTGTGTGCTCGCTCATTTCTTCGCCCTGTACGCCAGCATCAAT
TCCTTCCACCACCTGGAAGTGATCAACACCACCAATAACGAGCACTACACATGGCCAATACAGACCGGCA
AGCAACCGCTGATCTAG