SecReT6
Protein ID: 395443819
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00336
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]180045..180980 [+]
Producthypothetical protein
NoteTssG
UniProt IDI3UN86
KEGG IDppi:YSA_00336
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-80, Aligned region: 3..294
Protein Sequence: 311 a.a.     [Download]
>gi|395443819|ref|YP_006384072.1| hypothetical protein YSA_00336 [Pseudomonas putida ND6]
MLERLHGLHGDDLEPRWPDKATRRRVRLACDPRLTFPVSDVYKAQRVPAEEARYRIIATFLGLHGTDSPL
PTYYLEQVAYEHAHGIGVRPAFFDFFNHYLLSLLHRIWRKYRYYIRFQPGASDGFSQYVFALLGLNDKQL
RGDTALPWSRLLSFAGVIASRSRAPGTVAGIIAHCFDLNQVHIREFETRSVVTPSRQLARLGRTNGQLGS
TFMIGSRTRTRSSKFTIVISELDQTQLRDLLPSGINFGRLRALIDFLLRDGLAYDLELRLKPSALSPFCL
HRSQGAYLGWTSFVDDRHGQISPVVRIRGRS
 
Nucleotide Sequence: 936 bp     [Download]
>gi|395443650|ref|NC_017986.1|:180045-180980 Pseudomonas putida ND6 chromosome, complete genome
TTGCTGGAGCGGTTGCACGGGCTGCATGGCGATGACCTGGAACCCCGTTGGCCGGACAAGGCCACCCGGC
GGCGCGTGCGCCTGGCCTGCGACCCACGACTGACCTTCCCTGTTTCGGACGTGTACAAAGCCCAGCGGGT
GCCCGCCGAGGAAGCGCGCTACCGCATCATTGCCACGTTCCTGGGGTTGCACGGCACCGATTCGCCATTG
CCCACCTATTACCTGGAACAGGTGGCGTATGAACATGCGCATGGCATCGGTGTACGCCCGGCCTTCTTCG
ACTTCTTCAACCACTACCTGCTCAGCCTGTTGCACCGTATCTGGCGCAAGTACCGCTATTACATCCGCTT
CCAGCCAGGTGCCAGTGACGGGTTCTCGCAGTACGTGTTTGCCCTGCTTGGGCTTAACGACAAGCAGTTA
CGAGGGGACACGGCGCTGCCCTGGAGCCGCCTGCTCAGTTTTGCCGGCGTGATCGCCAGCCGCAGCCGTG
CGCCGGGCACTGTGGCCGGCATCATTGCGCACTGCTTCGACCTCAATCAGGTGCACATCCGCGAGTTCGA
GACGCGATCAGTCGTCACGCCGTCCAGGCAGCTTGCAAGGCTGGGGCGGACCAATGGCCAGCTGGGCAGC
ACGTTCATGATTGGCAGCCGCACGCGCACTCGCAGCAGCAAGTTCACCATCGTGATCAGCGAACTCGACC
AGACACAGCTGCGGGACTTGCTGCCCAGCGGCATCAACTTCGGCCGTTTGCGTGCACTGATCGACTTTCT
GCTGCGTGACGGGCTGGCCTACGACCTGGAACTGCGCCTTAAGCCGAGCGCGTTGTCCCCCTTCTGCTTG
CACCGCAGCCAGGGCGCATACCTGGGCTGGACCAGCTTCGTCGATGACCGGCATGGCCAGATCAGCCCGG
TTGTACGCATCCGGGGGCGCTCATGA