SecReT6
Protein ID: 395443821
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00340
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]181543..182340 [+]
Producthypothetical protein
NoteTssJ
UniProt IDI3UN88
KEGG IDppi:YSA_00340
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-24, Aligned region: 17..64
T6SS-SciN [PF12790], Evalue: 1.60E-24, Aligned region: 156..256
Protein Sequence: 265 a.a.     [Download]
>gi|395443821|ref|YP_006384074.1| hypothetical protein YSA_00340 [Pseudomonas putida ND6]
MKPHPLLLATLLLALVVPTGCTSLSRMSQVAMDHSLPIGPPKDHPTEVAFSINASPTLNGNPNSLDVAAE
QDSALEPSPYAVTLSAGDPYALTEKIGVLFEYLQAQFPAMSPVELDEGDESDPARSPLEESGPGSYDDPQ
VALTLPRTTSVASALVATPIAITILQLRDDSLLRNTVYQLLEQDPAKALRSTYIRSDDYLLRPGQFKYIP
FEPIHAETRFVAVIADYRGHENASWRQVLRIPPRGRQIMLSVLVNDTHIVLKEED
 
Nucleotide Sequence: 798 bp     [Download]
>gi|395443650|ref|NC_017986.1|:181543-182340 Pseudomonas putida ND6 chromosome, complete genome
ATGAAACCTCATCCACTTCTGCTCGCCACCCTGTTGCTTGCGCTGGTCGTGCCCACCGGCTGTACCTCTT
TGAGCAGAATGAGCCAGGTGGCCATGGACCACTCGTTGCCCATCGGGCCGCCCAAGGATCACCCGACCGA
GGTCGCATTCAGCATCAATGCCAGCCCTACCCTCAACGGCAATCCGAACAGCCTTGACGTCGCAGCCGAA
CAGGATAGCGCCCTGGAGCCCAGCCCCTACGCTGTAACCCTGAGTGCTGGCGACCCCTATGCGTTGACCG
AAAAAATCGGGGTTCTGTTCGAATACCTGCAAGCGCAATTCCCGGCCATGTCCCCCGTCGAGCTGGACGA
AGGAGACGAAAGCGACCCGGCGCGCTCACCCCTGGAAGAAAGCGGCCCCGGCAGCTACGACGACCCTCAG
GTGGCGTTGACCTTGCCGCGCACCACAAGCGTTGCCTCAGCGCTGGTCGCCACGCCCATTGCCATCACGA
TCCTGCAACTGCGCGACGACTCACTGCTGCGCAACACCGTGTACCAGCTACTGGAGCAGGACCCGGCCAA
GGCGCTGCGCAGTACCTACATCCGCAGTGACGATTACCTGCTGCGCCCTGGCCAGTTCAAGTACATCCCG
TTCGAGCCTATCCACGCCGAAACCCGCTTCGTCGCGGTGATTGCCGATTACCGAGGGCATGAAAACGCCA
GTTGGCGGCAAGTTCTGCGCATTCCGCCGCGTGGCCGCCAGATCATGCTGTCGGTGCTGGTCAACGACAC
GCACATCGTGCTCAAGGAAGAAGACTGA