SecReT6
Protein ID: 395443822
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00341
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]182396..183733 [+]
Producthypothetical protein
NoteTssK
UniProt IDI3UN89
KEGG IDppi:YSA_00341
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.00E-151, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|395443822|ref|YP_006384075.1| hypothetical protein YSA_00341 [Pseudomonas putida ND6]
MSSRNPVLWPEGLFVKPQHFQQATRASEAALHQRLASLNAAFYGFSELQLSDEYLSLGKVAITRARGVMP
DGTVFDIPADLPPPPPLEIGDDACQDSEVYLCLPLRTDGGREVSWPDNAANFRYTAQAQEIKDTHTADGD
LVQVDLAVPNLQLKRKTEDSSAYTRLALARILERRPDGSLQLDEAFYPTSVSVRAVPALQRFLEEITHTL
RERARGLATRIGASGQSGIADIRDFNLLQAMNRWWPCFQHLARQAQTHPEQLYLCMSQACGEFVTFTDQN
RLPQEYPAYHHTALRTSFKPLEDTLRRSLSTVLRPRAVSLPLESEQFGVMTTTLEDRRLIDEADFILAVR
ASMPPQALRQMFIQKAKITSLESLNDLVPLQLPGIPLLPLPVAPRDLPFHAGFSYFELDRRDPAWACMSK
ANGFGIHIAGDFPGLELQFWAIRSE
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|395443650|ref|NC_017986.1|:182396-183733 Pseudomonas putida ND6 chromosome, complete genome
ATGAGTTCACGCAATCCCGTTCTCTGGCCCGAAGGCCTGTTCGTCAAACCACAGCATTTCCAGCAGGCGA
CCAGGGCCAGCGAAGCAGCCCTGCACCAGCGCCTCGCCAGCCTCAACGCAGCCTTCTACGGCTTCAGCGA
ACTTCAGTTGAGCGACGAATACCTGAGCCTGGGCAAAGTCGCCATCACCCGGGCGCGCGGTGTGATGCCG
GACGGCACGGTGTTCGACATTCCCGCCGACCTGCCGCCACCGCCGCCGCTGGAAATCGGCGACGACGCGT
GCCAAGACAGTGAGGTGTATCTGTGCCTGCCGCTGCGTACCGATGGCGGCCGCGAAGTGAGTTGGCCCGA
CAATGCAGCCAATTTCCGCTATACCGCCCAGGCACAGGAAATCAAGGATACCCACACCGCTGACGGCGAC
CTGGTGCAGGTAGACCTTGCGGTGCCCAACCTGCAGCTCAAACGCAAGACCGAAGACAGCAGCGCCTACA
CCCGCCTGGCCCTGGCACGTATTCTGGAACGGCGCCCCGACGGCAGCCTGCAACTGGACGAAGCGTTCTA
CCCCACCAGCGTTTCGGTGCGGGCGGTGCCAGCGCTGCAGCGGTTTCTTGAAGAAATCACCCATACCTTG
CGCGAGCGGGCGCGCGGCCTCGCCACGCGGATTGGTGCATCGGGCCAGTCCGGGATCGCCGACATTCGCG
ACTTCAACCTGCTGCAGGCAATGAACCGTTGGTGGCCATGCTTCCAGCATCTGGCCAGGCAAGCGCAAAC
GCACCCCGAGCAGCTGTACCTGTGCATGAGCCAGGCCTGCGGCGAATTCGTCACCTTCACCGACCAGAAC
AGGCTCCCGCAGGAGTACCCCGCCTATCACCACACCGCGCTGCGCACCTCTTTCAAACCACTGGAAGACA
CCTTGCGTCGGTCTCTGAGCACCGTCTTGCGGCCACGCGCTGTTTCACTACCGCTGGAGAGCGAACAATT
CGGTGTGATGACAACCACGCTGGAAGACCGCCGGCTGATCGACGAAGCCGACTTCATCCTCGCCGTGCGC
GCCAGCATGCCACCACAGGCGTTGCGCCAGATGTTCATCCAGAAAGCCAAGATCACCTCACTTGAGTCAC
TGAATGACCTGGTGCCGCTGCAATTGCCGGGCATCCCTTTGTTGCCATTACCCGTGGCGCCCCGCGACCT
GCCCTTCCATGCAGGCTTCAGCTACTTCGAGCTGGACCGACGTGACCCGGCCTGGGCGTGCATGAGCAAG
GCGAATGGCTTCGGCATCCACATTGCGGGCGACTTCCCAGGGCTTGAACTGCAGTTCTGGGCGATCAGGA
GTGAGTGA