SecReT6
Protein ID: 395443823
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00343
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]183735..184604 [+]
Producthypothetical protein
NoteTssL
UniProt IDI3UN90
KEGG IDppi:YSA_00343
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.70E-64, Aligned region: 67..272
Protein Sequence: 289 a.a.     [Download]
>gi|395443823|ref|YP_006384076.1| hypothetical protein YSA_00343 [Pseudomonas putida ND6]
MGKDNNTPTDENNAAVNALDSTLEQPAPAPRAAATNAQVSTDKPEPEPVSEGYPADPEFQLRGGFANLML
DAASPLFGLVIRLRTLDELPNIQDVHQQVRGQIDNIQEELRQHGYEPAQLLAYSYGLCLFIDEAVMERPW
GKSSCWSQEPLLSIFHDETWGGEKIFTVITRLMQEPKRYQEVLEFMYYALCLGLKGKYALAPKGEETLNA
LIHQLHGIIRELRGPTPEEVCDPYTNVAPRNFRMSRQWPWWSPLVISAIAMAVAYSIYSYRLHLITTEVL
ESLNGILQQ
 
Nucleotide Sequence: 870 bp     [Download]
>gi|395443650|ref|NC_017986.1|:183735-184604 Pseudomonas putida ND6 chromosome, complete genome
ATGGGAAAAGACAACAATACGCCCACCGATGAAAACAACGCTGCAGTCAACGCGCTTGATTCAACCCTTG
AACAGCCAGCACCCGCCCCCCGGGCTGCGGCAACCAATGCGCAAGTATCCACGGACAAACCTGAGCCTGA
GCCCGTTTCCGAAGGCTACCCCGCTGACCCGGAATTTCAGCTGCGGGGCGGCTTCGCCAACCTGATGCTG
GATGCCGCATCACCGTTGTTCGGCTTGGTTATACGCCTGCGTACGCTGGACGAGCTGCCAAATATCCAGG
ACGTGCACCAGCAAGTGCGCGGCCAGATCGACAACATTCAGGAAGAACTGCGCCAGCACGGTTACGAGCC
CGCCCAGCTGTTGGCGTACTCCTACGGTCTGTGCCTGTTCATAGACGAGGCCGTTATGGAGCGGCCCTGG
GGTAAGAGCAGCTGCTGGAGCCAGGAGCCGCTGCTCAGCATCTTCCACGACGAGACCTGGGGTGGGGAAA
AAATCTTCACGGTGATTACCCGCCTGATGCAGGAGCCCAAGCGTTATCAGGAGGTACTTGAGTTCATGTA
CTACGCCCTGTGCCTTGGGCTGAAGGGCAAGTACGCGCTCGCGCCGAAAGGCGAAGAAACACTCAACGCA
TTGATTCACCAACTGCACGGGATCATCCGCGAACTGCGCGGCCCTACCCCCGAAGAAGTCTGCGACCCCT
ACACCAATGTGGCCCCACGCAACTTCCGCATGAGCCGGCAATGGCCCTGGTGGAGCCCCTTGGTGATTTC
CGCCATCGCCATGGCGGTGGCTTACAGCATCTACAGCTATCGCCTGCACCTGATTACCACCGAGGTGCTG
GAGTCGCTGAACGGCATTTTGCAGCAATAG