SecReT6
Protein ID: 395443825
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00347
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]184737..185252 [+]
Producthypothetical protein
NoteTssD
UniProt IDI3UN92
KEGG IDppi:YSA_00347
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-38, Aligned region: 6..155
Protein Sequence: 171 a.a.     [Download]
>gi|395443825|ref|YP_006384078.1| hypothetical protein YSA_00347 [Pseudomonas putida ND6]
MPTPAYIKIVGQTQGNITAGAFTADSVGNVFQQGHEDQILVQEIKHEVTTPTDPQSGQPSGQRVHKPFIF
TSSLNKATPLMYQALATGEMLPTVEVSWYRTSEEGKQEHFFTTTLEDATIVSINTVLPHALDKDNENYTQ
LIEVSLAYRKITWAHDVANTEGSDDWRNPIA
 
Nucleotide Sequence: 516 bp     [Download]
>gi|395443650|ref|NC_017986.1|:184737-185252 Pseudomonas putida ND6 chromosome, complete genome
ATGCCAACACCCGCTTACATCAAGATCGTAGGCCAGACCCAAGGCAACATCACCGCTGGCGCCTTCACCG
CTGACTCCGTCGGCAACGTGTTCCAACAAGGCCATGAAGATCAAATTCTGGTTCAGGAAATCAAGCATGA
GGTGACTACGCCCACTGACCCCCAGAGCGGTCAACCGAGTGGCCAGCGCGTGCATAAGCCTTTCATATTC
ACCAGTTCACTGAACAAAGCTACCCCCCTGATGTATCAGGCACTTGCCACCGGCGAAATGCTGCCAACGG
TCGAAGTCAGCTGGTATCGCACCTCGGAGGAAGGCAAGCAAGAGCACTTTTTCACGACCACGCTAGAAGA
CGCCACCATCGTCAGCATCAATACCGTGCTTCCCCATGCACTCGACAAAGACAATGAAAACTACACACAA
CTGATTGAAGTATCCCTGGCGTATCGAAAGATCACGTGGGCTCACGATGTAGCCAATACCGAAGGTTCTG
ACGACTGGCGCAATCCGATCGCCTGA