SecReT6
Protein ID: 395443826
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00348
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]185326..187494 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDI3UN93
KEGG IDppi:YSA_00348
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-57, Aligned region: 28..349
Phage_base_V [PF04717], Evalue: 1.50E-19, Aligned region: 391..484
Gp5_C [PF06715], Evalue: 1.10E-05, Aligned region: 529..547
Gp5_C [PF06715], Evalue: 1.10E-05, Aligned region: 532..555
Gp5_C [PF06715], Evalue: 1.10E-05, Aligned region: 548..571
Gp5_C [PF06715], Evalue: 1.10E-05, Aligned region: 565..586
Gp5_C [PF06715], Evalue: 1.10E-05, Aligned region: 610..620
Protein Sequence: 722 a.a.     [Download]
>gi|395443826|ref|YP_006384079.1| Rhs element Vgr protein [Pseudomonas putida ND6]
MPSQSDLRYSFEPLVGKTEFEVVSFELREGISTPFELELKLISFENDIDFGHLLDKPVLFTIWEGGRPVR
YVHGLVSRFSQAESGFYRTYYDALIEPQLARASLRSNWRIFQQKTVPQILELMLKRQGIDQYALRASLDH
QVREFCVQAGETDLDFIARLAAEEGFVYRFEHNEKRHKLIITDRLQSLGLISHGVIKHEDDAEGFYRERE
PSAPDTVLYHSNHGGDQPQPCLRRLRYSEQVRTARQVQRDYTFTHPAYRQEHRASGPYLEHQSTDYECFD
YPGRYKRDAVGKPFTENRITGLRHDVRIAQVQGDDVRLQPGLSFTLTGHPREDLNVHWRVSTVRHEGSQF
TSLQEEAAGADQGTRYEQKAVLVPGRAEWRPAPLPKPRVDGPHMATVVGPPGEEIYCDEWGRVKVSFPWD
RESQDNAFSSCWVRVSQGWAGGSWGSMAIPRIGQDVIIHYVNGDPDQPMITGRTYCGNQLPPYDLPRHKT
RMTIKSQTHKGDGFNELRFEDELGQEEVFIHAQRDQNNVVKHDETTQVGNDRKEQVDHDESILIGHDRTE
TVGNDEHITIGQDAALDIGRNHTIRIAKDRVENIGNHRHDQIAANHHTRIGGNFEQRVEGHAELEARGDI
RRRTRRYELRASEAVVIQGPGGSIRIDETGITLDSPTIRITGQMLKSANGTTSPFSISSAPNTGKPLERL
CGRRPDGTCPLPDCRCIRGPGQ
 
Nucleotide Sequence: 2169 bp     [Download]
>gi|395443650|ref|NC_017986.1|:185326-187494 Pseudomonas putida ND6 chromosome, complete genome
ATGCCTAGCCAATCTGATTTACGCTACAGCTTTGAACCACTCGTGGGCAAGACTGAGTTCGAAGTGGTGT
CGTTCGAACTACGAGAAGGGATCAGCACACCCTTCGAACTGGAGCTGAAATTGATCAGCTTCGAGAACGA
TATCGACTTCGGCCACCTGCTCGACAAACCGGTGCTCTTCACCATCTGGGAAGGCGGACGCCCAGTACGC
TACGTGCACGGTCTGGTCAGTCGTTTCAGCCAAGCGGAAAGTGGCTTCTACCGCACCTACTATGACGCGC
TGATCGAGCCACAGCTGGCCCGTGCCAGCCTGCGTTCGAACTGGCGCATCTTCCAGCAGAAGACCGTGCC
GCAAATTCTTGAACTGATGCTCAAGCGCCAGGGCATCGACCAGTACGCACTACGCGCCAGCCTGGACCAC
CAGGTGCGCGAATTCTGCGTTCAGGCCGGCGAAACCGACCTCGACTTCATCGCCCGCCTGGCGGCCGAAG
AAGGCTTTGTCTACCGCTTCGAGCACAATGAAAAACGCCATAAGCTGATCATCACCGACAGACTGCAGTC
ACTCGGTCTGATAAGTCACGGTGTCATCAAACACGAGGACGACGCCGAAGGCTTCTACCGTGAGCGTGAA
CCGTCAGCCCCAGACACCGTGCTGTACCATTCCAACCACGGCGGCGACCAGCCTCAACCGTGCCTACGGC
GCTTGCGCTACAGCGAACAGGTGCGTACTGCACGGCAGGTTCAACGCGACTACACCTTCACCCACCCGGC
CTATCGTCAGGAACACAGGGCCTCGGGCCCGTATCTTGAGCACCAGTCCACGGACTATGAGTGCTTCGAC
TACCCCGGCCGTTACAAACGCGATGCCGTTGGCAAGCCGTTCACCGAAAACCGCATCACCGGCTTGCGCC
ATGACGTGCGTATTGCCCAAGTGCAAGGCGACGATGTGCGCTTGCAACCAGGCCTGAGCTTCACCCTGAC
AGGCCACCCGCGCGAAGACCTGAATGTGCATTGGCGGGTCAGCACGGTTCGCCACGAAGGCAGCCAGTTC
ACCAGCCTGCAGGAAGAAGCTGCCGGGGCCGACCAGGGCACACGTTACGAGCAAAAGGCGGTACTGGTGC
CAGGCAGAGCCGAGTGGCGCCCAGCCCCGTTGCCCAAACCACGCGTTGACGGCCCGCACATGGCCACCGT
GGTGGGGCCGCCCGGTGAAGAGATCTACTGCGACGAATGGGGCCGGGTCAAGGTCAGCTTCCCCTGGGAC
AGAGAAAGCCAGGACAACGCGTTCAGTTCCTGCTGGGTACGCGTATCCCAAGGCTGGGCCGGCGGCAGCT
GGGGCTCGATGGCCATCCCACGGATTGGCCAGGACGTGATCATCCACTACGTCAACGGCGACCCCGACCA
GCCGATGATCACCGGCCGTACTTACTGCGGTAACCAGCTGCCACCGTACGACCTTCCCCGTCACAAGACC
CGCATGACCATCAAGAGCCAGACCCACAAGGGCGATGGCTTCAACGAGCTGCGCTTCGAGGACGAACTGG
GCCAGGAGGAAGTGTTCATTCATGCCCAGAGGGACCAGAACAATGTGGTCAAGCACGATGAGACTACGCA
GGTCGGCAATGACCGCAAAGAGCAGGTCGATCACGACGAATCGATCCTGATCGGCCACGACCGTACGGAA
ACGGTTGGCAATGACGAGCACATCACCATCGGGCAGGACGCCGCGCTCGACATCGGCAGAAACCACACGA
TCAGGATCGCCAAGGACCGTGTCGAAAACATCGGCAATCACCGTCACGACCAGATCGCCGCCAATCACCA
CACCCGTATCGGTGGCAACTTCGAACAACGGGTCGAAGGGCATGCCGAGCTGGAAGCCCGTGGGGATATC
CGCAGACGTACTCGCCGTTATGAACTTCGAGCCTCGGAAGCCGTGGTCATCCAAGGCCCTGGTGGCTCCA
TTCGAATCGACGAAACGGGCATCACCCTGGACAGCCCGACGATTCGCATCACCGGCCAGATGCTCAAGTC
GGCAAATGGGACGACAAGCCCCTTTTCCATCAGCAGTGCACCGAACACCGGCAAGCCTCTGGAGCGCTTG
TGTGGGCGCCGCCCTGATGGTACCTGCCCCCTGCCCGATTGCCGCTGTATCCGAGGGCCAGGCCAATGA