SecReT6
Protein ID: 395449296
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10446
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5580570..5581655 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDI3V3W3
KEGG IDppi:YSA_10446
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.30E-22, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 5.30E-22, Aligned region: 241..257
Protein Sequence: 361 a.a.     [Download]
>gi|395449296|ref|YP_006389549.1| ImpA domain-containing protein [Pseudomonas putida ND6]
MPEILNDLSLATLVAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEQVINLSAQGL
AQQSKDLMLVAWLCEGLAQREHFEGITFGLELTEQLLVAFWETLYPTLEDGLDERAARLSWLKTTLTDIA
GGLPIIQGQHFGVLRYDESRHVENLALQNPKAMQTALNEGKINAEIFQRSVALTDTDYLRAKAQQIATSL
NACKRLQASADRLFGHEAPSFASLADMLSRASQLAEKLLKDRGVELHPAIPEEAQPQATGANLHEAGEAM
NATPPTTAPAALRTTPLTRDEAFTMLAGIAQYFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDNNV
VDNIRDVLGTR
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5581655-5580570 Pseudomonas putida ND6 chromosome, complete genome
ATGCCTGAAATTCTCAATGACCTCTCGCTGGCCACACTGGTCGCCCCTATCGAGGGTGGCAGTGGCGAAG
ACTTGAGCTTCTCTGCCTTGTTCGACCAGATCAAGGAGGCACGCCGGGCGGACCCAGACTACCTGACCCA
GGGCGACTGGCAAACCGACTTGAAGACTGCCGACTGGGAGCAGGTGATCAACCTGTCGGCTCAAGGGCTT
GCGCAGCAAAGCAAAGACCTGATGCTGGTGGCCTGGCTCTGCGAGGGGCTGGCCCAGCGTGAACACTTCG
AAGGCATCACCTTTGGCCTCGAGCTGACCGAACAGCTCCTGGTTGCGTTCTGGGAAACGCTGTACCCCAC
CCTCGAAGACGGCCTGGACGAGCGCGCGGCGCGACTGTCCTGGTTGAAGACCACGCTCACCGACATTGCC
GGTGGCTTGCCCATTATCCAAGGGCAGCATTTTGGCGTGTTGCGCTATGACGAATCACGCCATGTAGAAA
ACCTCGCCTTGCAAAACCCCAAGGCGATGCAGACAGCGCTGAACGAAGGCAAGATCAACGCCGAGATCTT
CCAGCGCTCGGTAGCGCTTACCGACACCGATTACCTGCGCGCCAAGGCCCAGCAGATCGCTACCAGCCTG
AATGCATGCAAACGCCTGCAGGCCAGCGCCGACCGCCTGTTCGGCCACGAGGCGCCCAGCTTTGCCAGCC
TTGCCGACATGCTTTCGCGTGCCAGCCAGCTGGCGGAAAAACTGCTCAAGGACCGCGGCGTCGAGCTACA
CCCCGCCATCCCGGAAGAAGCACAGCCACAGGCCACGGGTGCCAACCTCCACGAAGCAGGTGAAGCGATG
AATGCCACGCCCCCGACGACCGCACCTGCAGCCCTGCGCACCACCCCGCTGACCCGCGACGAGGCATTCA
CCATGCTTGCGGGCATCGCCCAGTACTTCAAACAGAGCGAACCGCAAAGCCCGGTACCCTACCTGATCGA
ACGTGCGATCAAGTGGGGCAACATGCCGTTGGAAGGCTGGTTGAGTGACGTGATCAAGGACAACAATGTG
GTGGACAACATCCGCGATGTGCTGGGCACCCGCTAG