SecReT6
Protein ID: 395449297
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10449
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5581751..5582293 [-]
Producthypothetical protein
NoteTssD
UniProt IDI3V3W4
KEGG IDppi:YSA_10449
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-41, Aligned region: 14..154
Protein Sequence: 180 a.a.     [Download]
>gi|395449297|ref|YP_006389550.1| hypothetical protein YSA_10449 [Pseudomonas putida ND6]
MLLMESFTMAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRK
AVDKASAKLFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVKFVAGGNQNGEDKAVSDLPVE
EISFNFARIKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
 
Nucleotide Sequence: 543 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5582293-5581751 Pseudomonas putida ND6 chromosome, complete genome
ATGTTGTTAATGGAGAGTTTCACAATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCAGGTGAAG
TACTGGATGAAAAACACAAGGACTGGATCGAAGTGCTGGGCTACGAGTACGGCGCCACACAGGCTACGTC
GGCAACCGCCAGCTCTTCGGGCGGTGCGTCCTCCGAGCGCGTTGCCCTGAGCGACTTCAAGATCCGCAAG
GCAGTCGACAAGGCATCGGCCAAACTGTTCGAACACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAGC
TGAACGTGAACCGCGCCGGTGGTGACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTGGTGGTCTC
TTCGGTCAAGTTTGTCGCCGGTGGCAATCAGAATGGTGAAGACAAGGCGGTCAGCGACCTGCCCGTTGAA
GAAATCAGCTTCAACTTTGCCCGCATCAAGACCACCTACACCCAGCAGAACCGTACCGACGGCCAGGCCG
GCGGCAACATCGTGGGTGGCTGGGACCGCACCGCGAACAAAGTGTTTGCCTAA