SecReT6
Protein ID: 395449301
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10457
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5589644..5590360 [-]
Producthypothetical protein
NoteTssL
UniProt IDI3V3W8
KEGG IDppi:YSA_10457
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-53, Aligned region: 21..221
Protein Sequence: 238 a.a.     [Download]
>gi|395449301|ref|YP_006389554.1| hypothetical protein YSA_10457 [Pseudomonas putida ND6]
MTEAVLQQGAVPAASDKPTFKDLVQDFISMALIVRRGRQVTSVQAFEGSVERFFANLERDARAANYSVEQ
VKDTQYALCAFLDESVLRSDDNALRRHFELQPLQFRYFGVHLAGEGFFEKVDALRADVKQNIDVLEVYHL
CLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVPLWVYLALIALVC
VAVYLTLDWLLDKDVAALSEQIRQLFSA
 
Nucleotide Sequence: 717 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5590360-5589644 Pseudomonas putida ND6 chromosome, complete genome
ATGACCGAAGCCGTACTGCAACAGGGCGCCGTCCCGGCCGCCAGCGACAAACCGACGTTCAAGGACCTGG
TCCAGGACTTCATCAGCATGGCGTTGATCGTACGTCGCGGCCGCCAGGTCACCTCGGTGCAGGCCTTCGA
AGGTAGCGTCGAACGCTTCTTCGCCAACCTGGAACGTGATGCCCGTGCCGCCAACTACAGCGTCGAGCAG
GTCAAGGACACCCAATACGCGTTGTGCGCCTTCCTCGACGAAAGCGTACTGCGCTCGGACGACAACGCGT
TGCGTCGGCACTTTGAACTTCAGCCGTTGCAGTTCCGCTATTTCGGCGTGCACCTGGCCGGCGAAGGGTT
CTTCGAGAAGGTCGATGCGCTGCGCGCCGACGTCAAGCAGAACATCGACGTGCTCGAGGTCTACCACCTG
TGCCTGGCACTGGGCTTCGAGGGCAAGTTCAGCCTCGGCCAGAAGGACCAGCTGCGTTACCTGGCCAATA
CCCTGGGCCAGGATATCGCCCGCTACCGCAAAGCGCCCAAAGCCCTGTCACCGGACTGGGCACTGCCCGA
CCAGGTGTCGCAAATGCTGCGCCATGAAGTACCGCTGTGGGTGTATCTGGCGCTGATCGCGTTGGTCTGC
GTCGCCGTGTACCTGACGCTGGACTGGTTGCTGGACAAGGACGTCGCCGCCCTGTCCGAACAAATTCGCC
AGCTGTTCAGTGCCTGA