SecReT6
Protein ID: 395449302
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10459
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5590357..5591700 [-]
Producthypothetical protein
NoteTssK
UniProt IDI3V3W9
KEGG IDppi:YSA_10459
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-136, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|395449302|ref|YP_006389555.1| hypothetical protein YSA_10459 [Pseudomonas putida ND6]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRSTPFHWGVQALQVDEDALANGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVYAALKLPEPFGLNYVEDGHEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVLLVDGDSLDGYSHCPLAKLTRNSMGGFNVDPHFVHPTLHLGSHETIAGIGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQCIVINLTQTKPSHWQGQLHDPRLAEADFYI
AVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGTVYER
MISAQAICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5591700-5590357 Pseudomonas putida ND6 chromosome, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTATCAGG
ACGAATTCCATCAGCACCAGTTGGCTGAGGCGACCCTGCGCAGCACCCCTTTCCATTGGGGGGTTCAGGC
GCTGCAGGTGGACGAGGACGCCCTGGCCAATGGTTCACTGCAGCTCAAGCGCCTGAAGCTGGTGTTCCCC
GATGGCAGCCTCTACGACGCGCCGCAGCACGATCCGCTGCCGGCCGCGCGCGACCTCAAGGACCTGCTCA
AGGCCAACGACCTGAAGGTGTATGCCGCGCTCAAGCTGCCCGAGCCATTCGGCCTCAACTACGTCGAGGA
TGGCCATGAACACAAGGCCGCACGGCGTTTCCGCAAGCAGTTCGACACCCTGCCCGACCTTAATGAAGGC
GAACTGGAAAACGAAATCACCAGCTTGCGCCTGAACGTCGTGCTGCTGGTCGACGGTGACAGCCTCGACG
GTTACAGCCACTGCCCACTGGCCAAGCTGACACGCAACAGCATGGGCGGTTTCAACGTTGACCCACATTT
CGTCCACCCCACCTTGCACCTGGGCAGCCACGAGACCATTGCCGGCATCGGCAAGCGCCTGCTCGGCGCC
CTGCAGGCCAAGAGCAAGGCGCTTTCCGGCCGACGCCGCGAGCGCGCCGACCAGATCGCCGAGTTCGGCT
CCAGCGATGTGACCCTGTTCTGGCTGCTGAACACGGTCAACCGTGCCCACCCGCAGCTGGCGCATCTACT
GGCCCACCCGCGCCTGCACCCGGAGCGCCTGTACCTGTTCCTGGCGGACCTTGCCGGCGGCCTGCTGACC
TTCACCCTGGACACCCAGCTCAGCGACATCCCCGAGTACGACCACCACGACCCGGCCGCGTCGCTGGTCA
AGCTCGACGAAATGATCCGGGTGATGCTCGACAACGTTGTGCCCAACCAGTGCATTGTCATCAACCTGAC
CCAGACCAAGCCATCGCACTGGCAAGGCCAACTGCACGACCCGCGCCTGGCCGAAGCCGACTTCTATATC
GCCGTGCACGCCGACATGCCCGGCGCCAGCCTGCTGGAGCTGGTGCCCCGTGCCTTCAAGGTCGGTTCGC
CGGAAGACATTGAAGTGGTGGTCAACAGCGCCATGCCGGGTGTCACCCTCAATCATGCCGCGCGGCTGCC
GAACGCAATTCCGGTGCGCCTGGACAACCAGTACTTCGCCATCGAGCCACACGGCACTGTGTATGAGCGA
ATGATCAGCGCCCAGGCCATCTGCTTCTATGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA