SecReT6
Protein ID: 395449303
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10461
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5591697..5592419 [-]
Producthypothetical protein
NoteTssJ
UniProt IDI3V3X0
KEGG IDppi:YSA_10461
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-35, Aligned region: 18..172
Protein Sequence: 240 a.a.     [Download]
>gi|395449303|ref|YP_006389556.1| hypothetical protein YSA_10461 [Pseudomonas putida ND6]
MQHKHIVLKRLTAAALLVALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVV
MRVYQLTDLERFAATDAETLWDAPQKALGNTLVETREITLLPGIGQIDQWPLAKNARYVGVAAFFRDEQD
ARWKVAFDANSLRKDGIWFSSDGLRVLVDNTEISAMRGVDVLNKPPTADQLAAAQKAKDADATLTDKVQD
AAIDKATDAASQSASNAMDSTFNSLVDSVK
 
Nucleotide Sequence: 723 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5592419-5591697 Pseudomonas putida ND6 chromosome, complete genome
ATGCAACACAAGCACATCGTCCTCAAACGCCTGACCGCAGCCGCCTTGCTGGTAGCGCTGGCCGGCTGCG
GGGTCACCGACCGTATCGGCAAGCGCATGGAAGACAGCTGGGCGGCCGACATGCTGGCCGACAGCGAAAA
GGTCATCCTGACCTCCGACGGCGGCAACCAGCTCAACCCCGACGCCGAGGGCAAGCCGCTGTCGGTGGTG
ATGCGCGTGTATCAGCTGACCGACCTCGAGCGCTTCGCGGCTACCGATGCCGAGACCCTGTGGGACGCCC
CGCAAAAAGCCTTGGGCAACACCCTGGTGGAAACCCGCGAGATCACCCTGCTGCCCGGCATTGGCCAGAT
CGACCAGTGGCCGCTGGCCAAGAACGCGCGCTACGTCGGCGTGGCGGCGTTCTTCCGCGATGAGCAGGAC
GCGCGCTGGAAAGTCGCCTTCGACGCCAACTCGCTGCGCAAGGACGGTATCTGGTTCTCCTCCGACGGCC
TGCGGGTGCTGGTGGACAACACCGAAATCAGCGCCATGCGTGGCGTGGACGTACTGAACAAACCACCGAC
CGCCGACCAGCTTGCCGCTGCGCAGAAGGCCAAGGATGCCGACGCGACCCTCACCGACAAGGTGCAGGAC
GCGGCCATCGACAAAGCCACCGACGCCGCCAGCCAGTCGGCCAGCAACGCCATGGATTCAACCTTCAATT
CTTTAGTGGATAGCGTCAAATGA