SecReT6
Protein ID: 395449304
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10463
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5592444..5595041 [-]
ProductATPase
NoteTssH
UniProt IDI3V3X1
KEGG IDppi:YSA_10463
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.50E-44, Aligned region: 225..245
AAA_2 [PF07724], Evalue: 4.50E-44, Aligned region: 596..763
AAA_2 [PF07724], Evalue: 4.50E-44, Aligned region: 817..837
AAA [PF00004], Evalue: 6.90E-19, Aligned region: 62..79
AAA [PF00004], Evalue: 6.90E-19, Aligned region: 225..338
AAA [PF00004], Evalue: 6.90E-19, Aligned region: 602..720
AAA_5 [PF07728], Evalue: 3.00E-14, Aligned region: 225..247
AAA_5 [PF07728], Evalue: 3.00E-14, Aligned region: 387..450
AAA_5 [PF07728], Evalue: 3.00E-14, Aligned region: 601..722
ClpB_D2-small [PF10431], Evalue: 4.80E-14, Aligned region: 772..843
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 224..319
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 342..442
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 599..638
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 714..751
AAA_16 [PF13191], Evalue: 2.60E-08, Aligned region: 116..152
AAA_16 [PF13191], Evalue: 2.60E-08, Aligned region: 202..248
AAA_16 [PF13191], Evalue: 2.60E-08, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 2.60E-08, Aligned region: 466..527
AAA_16 [PF13191], Evalue: 2.60E-08, Aligned region: 596..642
AAA_16 [PF13191], Evalue: 2.60E-08, Aligned region: 666..690
AAA_16 [PF13191], Evalue: 2.60E-08, Aligned region: 788..803
Clp_N [PF02861], Evalue: 6.40E-08, Aligned region: 21..73
Clp_N [PF02861], Evalue: 6.40E-08, Aligned region: 103..124
Sigma54_activat [PF00158], Evalue: 6.20E-07, Aligned region: 221..258
Sigma54_activat [PF00158], Evalue: 6.20E-07, Aligned region: 601..727
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 204..239
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 278..379
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 600..643
AAA_19 [PF13245], Evalue: 4.40E-06, Aligned region: 225..246
AAA_19 [PF13245], Evalue: 4.40E-06, Aligned region: 599..623
AAA_17 [PF13207], Evalue: 8.80E-06, Aligned region: 225..319
AAA_17 [PF13207], Evalue: 8.80E-06, Aligned region: 602..639
NACHT [PF05729], Evalue: 9.00E-06, Aligned region: 225..254
NACHT [PF05729], Evalue: 9.00E-06, Aligned region: 601..626
NACHT [PF05729], Evalue: 9.00E-06, Aligned region: 709..749
AAA_14 [PF13173], Evalue: 4.00E-05, Aligned region: 225..358
AAA_14 [PF13173], Evalue: 4.00E-05, Aligned region: 600..682
AAA_23 [PF13476], Evalue: 0.00037, Aligned region: 225..241
AAA_23 [PF13476], Evalue: 0.00037, Aligned region: 459..501
AAA_23 [PF13476], Evalue: 0.00037, Aligned region: 599..699
Zeta_toxin [PF06414], Evalue: 0.00041, Aligned region: 138..168
Zeta_toxin [PF06414], Evalue: 0.00041, Aligned region: 220..249
Zeta_toxin [PF06414], Evalue: 0.00041, Aligned region: 595..641
AAA_18 [PF13238], Evalue: 0.0005, Aligned region: 225..267
AAA_18 [PF13238], Evalue: 0.0005, Aligned region: 603..626
AAA_29 [PF13555], Evalue: 0.0009, Aligned region: 218..241
AAA_29 [PF13555], Evalue: 0.0009, Aligned region: 599..626
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 219..247
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 479..507
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 601..620
AAA_25 [PF13481], Evalue: 0.0015, Aligned region: 225..249
AAA_25 [PF13481], Evalue: 0.0015, Aligned region: 282..320
AAA_25 [PF13481], Evalue: 0.0015, Aligned region: 350..380
AAA_25 [PF13481], Evalue: 0.0015, Aligned region: 474..500
AAA_25 [PF13481], Evalue: 0.0015, Aligned region: 599..625
RNA_helicase [PF00910], Evalue: 0.009, Aligned region: 226..246
RNA_helicase [PF00910], Evalue: 0.009, Aligned region: 602..623
RNA_helicase [PF00910], Evalue: 0.009, Aligned region: 702..720
Protein Sequence: 865 a.a.     [Download]
>gi|395449304|ref|YP_006389557.1| ATPase [Pseudomonas putida ND6]
MNLKSLFAKLNETSRTATESAAALCLSEHHYDVEVEHLLLQLLDNNDSDLAPILRHYEVVAERLQAQLVT
ALGTFKKGNTRTPALSPHITRMIEQAWLLASIEYGVGQVRSAHLLQALLDDAELRRVVIASAPELEKINA
DDLRLNLAALVEGSAESRQASPLASPAAPVSTSSKASGKTPALDQYTVNLTQSAREGRIDPVLGREFEVR
QMVDILTRRRQNNPILTGEAGVGKTAVVEGLALRIAQGDVPAVLKDVALHTLDLGLLQAGAGVKGEFENR
LKAVIEEVKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LARRFQVVKVEEPDEDKAIHMLRGLLGKMREHHKVAVMDEALVQAVRLSNRYITGRQLPDKAVSVLDTAC
ARIALAQSSLPGALEDCRRQIDNLQAEIGVLGHEAGKGHDHARRLEALQAALQAEQQQEQQLNAQWQQEL
ELVEQLKALDAANDADAQQLNTLRAELARVQGDQPLVHALVDSGAIAQVISGWTGIPLGKMLRDEIDTVQ
RLPALLGERVLGQDHALHEIGKRIKISRARMEDPNKPIGVFLLLGPSGVGKTETALALADTLYGGERNLI
TINMSEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVLD
DGEGREINFRNTVIILTSNTGTERIMQTCLNATELPTPEAIVEDLRDQLNHVFKPAFLGRLSIVPFYPVQ
DQILERIVALKLERIAKRFARNHQAELSYDQALVKAIAARCTEVDSGARNIDNILSQTLMPELAQRVLER
MAQDAPIQHLAIELGSDGDFAYRLA
 
Nucleotide Sequence: 2598 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5595041-5592444 Pseudomonas putida ND6 chromosome, complete genome
GTGAACCTGAAGTCTCTGTTCGCCAAGCTCAACGAAACCAGCCGCACGGCCACCGAAAGCGCGGCGGCCC
TGTGCCTGTCGGAGCACCATTACGACGTGGAAGTGGAGCACCTGCTGCTGCAGTTGCTCGACAACAACGA
CAGCGACCTGGCCCCGATCCTGCGCCACTACGAGGTCGTCGCCGAACGCCTGCAGGCGCAGCTGGTCACC
GCCTTGGGCACCTTCAAGAAAGGCAATACCCGCACCCCGGCGCTGTCGCCACACATTACCCGCATGATCG
AGCAAGCCTGGTTGCTGGCCTCGATCGAATACGGCGTAGGCCAGGTGCGCAGCGCTCACCTGCTGCAGGC
TCTGCTTGACGATGCTGAACTGCGTCGCGTGGTGATCGCCTCGGCGCCGGAGCTGGAAAAAATCAACGCC
GATGACCTGCGCCTGAACCTTGCCGCGCTGGTGGAGGGTAGCGCCGAGTCCAGGCAGGCCAGCCCACTGG
CCAGCCCAGCGGCGCCAGTGAGCACGTCGAGCAAGGCCAGCGGCAAGACCCCGGCACTTGACCAGTACAC
GGTCAACCTTACCCAAAGCGCCCGCGAAGGCCGCATCGACCCGGTGCTGGGCCGTGAGTTCGAAGTACGG
CAGATGGTCGACATCCTCACCCGCCGTCGGCAGAACAACCCGATCCTCACGGGCGAAGCCGGGGTCGGCA
AAACCGCAGTGGTCGAAGGCCTGGCGCTGCGCATCGCCCAGGGTGACGTGCCGGCGGTGCTCAAGGACGT
TGCCCTGCACACCCTCGACCTGGGCCTGTTGCAGGCCGGCGCCGGGGTCAAGGGCGAGTTCGAGAACCGC
CTCAAGGCTGTGATCGAAGAGGTCAAGCGCAGCCTGCACCCGATCATTCTGTTCATCGACGAAGCCCACA
CCCTGATCGGCTCCGGCGGCCAGGCCGGGCAGAACGATGCCGCCAACCTGCTCAAGCCGGCCCTGGCCCG
TGGCGAGTTGCGCACCATCGCTGCCACTACCTGGGCCGAATACAAGAAGTACTTCGAGAAGGACGCCGCC
CTCGCCCGCCGCTTCCAGGTGGTCAAAGTGGAAGAGCCCGACGAAGACAAGGCCATTCACATGCTGCGCG
GCCTGCTCGGCAAGATGCGCGAGCACCACAAGGTGGCGGTGATGGACGAAGCGCTGGTGCAGGCGGTACG
CCTGTCCAACCGCTACATCACCGGCCGCCAGCTGCCCGACAAGGCGGTCAGCGTGCTCGACACAGCCTGC
GCGCGCATTGCCCTGGCGCAATCTTCGCTGCCCGGCGCACTGGAAGACTGCCGCCGGCAGATCGACAACC
TGCAAGCAGAAATCGGCGTGCTCGGCCACGAAGCCGGCAAGGGGCACGACCATGCCCGCCGCCTGGAAGC
GCTGCAGGCTGCCCTGCAGGCCGAGCAGCAGCAGGAACAGCAACTCAATGCCCAGTGGCAGCAGGAGCTG
GAACTGGTCGAACAGCTCAAGGCGCTGGACGCCGCCAACGATGCCGACGCCCAACAGCTCAATACCCTGC
GTGCCGAGCTGGCGCGCGTGCAAGGCGACCAGCCACTGGTCCACGCGCTGGTCGACAGCGGCGCCATCGC
CCAGGTCATCAGCGGCTGGACCGGCATCCCGCTGGGCAAGATGCTGCGTGACGAAATCGATACCGTGCAG
CGCCTGCCGGCCCTGCTTGGTGAACGCGTGCTGGGCCAGGACCACGCCCTGCATGAGATCGGCAAGCGCA
TCAAGATTTCCCGAGCGCGCATGGAAGACCCGAACAAACCGATTGGCGTGTTCCTGCTGCTCGGCCCCAG
CGGCGTCGGCAAGACCGAAACCGCCCTGGCCCTGGCCGACACCTTGTACGGCGGCGAGCGCAACCTGATC
ACCATCAACATGTCCGAGTACCAGGAGGCCCACACCGTGTCGAGCCTCAAGGGCTCGCCACCCGGCTACG
TCGGCTACGGCGAAGGCGGCGTGCTGACCGAAGCGGTGCGCCGCAAGCCGTACAGTGTGGTGCTGCTCGA
CGAGGTGGAAAAAGCCCACCCCGACGTGCTCGAACTGTTCTTCCAGGTGTTCGACAAGGGCGTGCTGGAC
GATGGCGAAGGCCGCGAGATCAATTTCCGCAACACGGTGATCATCCTCACCTCCAACACCGGCACCGAGC
GCATCATGCAGACCTGCCTGAACGCCACCGAGCTGCCGACGCCCGAGGCGATCGTCGAAGACCTGCGCGA
CCAGCTCAACCATGTGTTCAAACCGGCCTTCCTCGGTCGCCTGAGCATCGTGCCGTTCTACCCGGTGCAG
GACCAGATCCTCGAGCGCATCGTCGCCCTCAAGCTCGAACGCATCGCCAAGCGCTTCGCCCGCAACCACC
AGGCCGAGCTCAGCTATGACCAGGCGCTGGTCAAGGCCATCGCCGCGCGCTGCACCGAGGTCGACAGCGG
CGCACGCAACATCGACAACATCCTGTCCCAGACCCTGATGCCCGAACTCGCCCAGCGCGTGCTCGAGCGC
ATGGCCCAGGACGCGCCGATCCAGCACCTTGCGATCGAGCTGGGCAGCGATGGCGATTTCGCCTATCGCC
TGGCCTGA