SecReT6
Protein ID: 395449305
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10464
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5595038..5596024 [-]
Producthypothetical protein
NoteTssG
UniProt IDI3V3X2
KEGG IDppi:YSA_10464
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.10E-97, Aligned region: 1..305
Protein Sequence: 328 a.a.     [Download]
>gi|395449305|ref|YP_006389558.1| hypothetical protein YSA_10464 [Pseudomonas putida ND6]
MRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSDLHFEREGKVSPAGLPLSEVQVTFMGLVG
PSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYEAWQKYKFHIEHERNGTSGFDGYLLNLVG
LGPRAQKLKFEEQPSALRRELFSYFAGLLSQKPRNALNLERMLGFYFSLPIKVQPFAGRWLHLQPEQCTQ
LGRRNAQLGHSAVAGNRVWDYQSCIRIELGPLNLADYQRFQPGTACYRKLVELVRFYIGAELDFEIAPRL
KREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIPYDGVAL
 
Nucleotide Sequence: 987 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5596024-5595038 Pseudomonas putida ND6 chromosome, complete genome
GTGCGCCTGCTCCGCCTGCACTACAGCCGCACCGGGCGCATGGACCTGGCAACCCGGCCGCACGAAGACC
CGCTGCGTTTTCGTACCCAGCTGTCGCTGGCGTTCCCGGCCAGCGAGGTCAGCGACCTGCACTTCGAGCG
CGAAGGCAAGGTGTCGCCGGCCGGCTTGCCGCTGTCGGAAGTGCAGGTCACCTTCATGGGCCTGGTCGGG
CCGTCGGGCGTGCTGCCACGCCCGTACACCGAGCTGCTGCTCGAGCGCCACGTGCAGTATCGCGACGATG
CCGCCCATGCGTTTCTCGACATCTTCTCGCACCGCATGACCACGCTGTTCTACGAGGCCTGGCAAAAATA
CAAATTCCACATCGAGCACGAGCGCAATGGCACTTCGGGCTTCGACGGCTACCTGCTCAACCTGGTTGGC
CTCGGGCCGCGCGCCCAGAAGCTGAAGTTCGAAGAGCAACCGTCAGCATTGCGTCGTGAGCTGTTCAGCT
ATTTTGCCGGCCTGCTCAGCCAGAAGCCGCGCAATGCGCTGAACCTTGAACGCATGCTCGGTTTCTATTT
CTCGCTGCCGATCAAGGTCCAGCCGTTCGCCGGGCGCTGGCTGCACCTGCAGCCCGAACAATGCACCCAG
CTTGGCCGCCGCAATGCCCAGCTCGGCCACAGCGCCGTCGCCGGCAACCGGGTCTGGGACTATCAGTCGT
GCATCCGTATCGAGCTGGGCCCGCTGAACCTGGCCGACTACCAGCGCTTCCAGCCGGGCACCGCCTGCTA
CCGCAAGCTGGTCGAGCTGGTGCGCTTCTATATAGGTGCCGAACTGGATTTCGAAATTGCCCCGCGCCTC
AAGCGCGAGGCGGTGCCACGCGCCCAACTGGGCCGCAGCGGCAATGTCGCCCTGGGCTGGCTGGGTTGGC
TCAAACGCCCGGGTCGTGACGCGGAGCCTTCGCGTTGCGCCGTTTTCCACATTCCTTACGATGGGGTCGC
CTTGTGA