SecReT6
Protein ID: 395449306
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10466
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5596072..5597892 [-]
Producthypothetical protein
NoteTssF
UniProt IDI3V3X3
KEGG IDppi:YSA_10466
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.80E-212, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|395449306|ref|YP_006389559.1| hypothetical protein YSA_10466 [Pseudomonas putida ND6]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIVELSLGRHEKVTEAYRVARHTEMHANPVEGVVCKFRTCYPVELWPIAV
QQASFTEMERSAFNGHSADLVAHLRIRLAATGDALFGQMDMNRLRFFLDGEATLMLQLYELLFNNLAKAT
LSFDDQGRSREVALPADALNTVGYARDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILQGKA
IEQVEVNFYFSDYDLSERLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVIPDTRLHNAA
EVVSIDRVKRVRKLGGIDQVATCQPFFEPRGEQDPHSSFWVARRRNQGDATAMSIRVVDRDLELIDASSD
TLSIGLTCSNRDVPLLLPFGGERGDFTIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHLSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFVRGVGITLTLDESQFIGSGVF
LFGKVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5597892-5596072 Pseudomonas putida ND6 chromosome, complete genome
ATGCTCGACGAACTGCTGCCCTACTACGAAAAGGAACTGTCGCACCTGCGCTTTCTCGGCCAGGAGTTTG
CCGCGCAGTACCCGAAGATCGCTTCGCGGTTGCTGATCGAGGGCGACAACTGCGAAGACCCGCACACCGA
GCGCCTGATCGAGGCGTTCTCGTTCCTGTCTGCGCGGGTGCACAAGAAGCTCGATGACGAGTTTCCGGAA
ATCGTCGAATCCTTCCTCGAGGTGCTGTACCCCCACTACCTGCGCCCTACTCCGTCGATGTCGATTGTCG
AACTGAGCCTGGGCAGGCACGAGAAAGTCACCGAAGCCTACCGCGTGGCGCGCCATACCGAGATGCATGC
CAATCCCGTGGAAGGCGTGGTGTGCAAGTTCCGCACCTGCTACCCGGTAGAGCTGTGGCCGATTGCCGTG
CAGCAGGCCTCGTTCACAGAAATGGAACGTTCGGCCTTCAACGGGCACAGCGCCGACCTGGTCGCTCATC
TGCGCATCCGCCTGGCAGCCACGGGCGATGCCCTGTTCGGGCAGATGGACATGAACCGCCTGCGGTTCTT
CCTCGACGGCGAAGCAACCCTGATGCTGCAGCTGTACGAGCTGCTGTTCAACAACCTGGCCAAGGCCACG
CTAAGCTTCGATGACCAGGGCCGCAGCCGCGAGGTGGCGCTGCCGGCCGATGCCCTGAACACCGTGGGCT
ACGCCCGTGACGAAGGCCTGGTGGACTACTCCGAGCGCTCATTCCTGGGCTACCGCCTGCTGCACGAGTA
TTTCACCTTCCCCGACAAGTTCATGTTCTTCGACCTCAGTGGATTTGCCCGCATCCTGCAGGGCAAGGCC
ATCGAACAGGTAGAGGTCAACTTCTATTTCTCCGACTACGACCTCAGCGAGCGCCTGGCGCGGCTGACCC
AGAACATCGGGCGCAACAACTTCAAGCTCAACTGCACGCCGATCATCAACCTGTTCCGCCAGCAGGCCGA
GCCGATCAAGCTGACCCACACCCAGCACGAATACCCGGTCATCCCTGACACACGGCTGCACAACGCTGCA
GAAGTGGTATCGATCGACCGGGTAAAGCGGGTGCGCAAACTCGGCGGTATCGACCAGGTCGCCACCTGCC
AGCCGTTTTTCGAACCCCGGGGTGAGCAAGACCCACACAGCAGCTTCTGGGTCGCGCGCCGGCGAAACCA
GGGTGACGCCACTGCCATGAGCATCCGCGTGGTCGACCGCGATCTGGAATTGATCGACGCCAGCAGCGAC
ACCCTCAGCATCGGCCTTACCTGCAGCAACCGCGACGTGCCGCTGCTGCTGCCGTTCGGTGGCGAACGGG
GCGATTTCACCATTCCCGCCAACTCGGTGATCAAGGACATCCGCTGCCTGCGCAAGCCCACCGCCACGGT
GCGCGTGCCCTTGGGCAAGGGCCTGATCTGGCGGTTGATCGCCCACCTGTCGCTGAACCACCTGTCCCTG
GTCAGCCAGGGCCGCGAAGTGCTGCTGGAGCTGTTGTCGCTGTACAACTACCGCAATGTTTCCGCCATTC
GCAAACAGATCAACGGCATCAAGGCGATCAGCAGCGAACCGGTGGTCGCGCGCATCGGCCACCCGCGGCC
AAATTTCGTGCGCGGGGTCGGCATCACCCTGACCCTGGACGAAAGCCAGTTCATCGGCAGCGGCGTGTTT
CTGTTCGGCAAAGTGCTGGACCACTTCTTCGGCCAGTACTGCTCGATGAACAGCTTCACCCAACTGACCC
TGCGCACCCAACAACGAGAAAAGAGAGTCGTACAATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTG
A