SecReT6
Protein ID: 395449307
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10467
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5597892..5598374 [-]
Producthypothetical protein
NoteTssE
UniProt IDI3V3X4
KEGG IDppi:YSA_10467
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|395449307|ref|YP_006389560.1| hypothetical protein YSA_10467 [Pseudomonas putida ND6]
MSNQARLLPSLLDRLLDDRPYQSAEPAAQRTCSLAEYKASIVRDLEVLVNTRQSLVAEELDGFSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5598374-5597892 Pseudomonas putida ND6 chromosome, complete genome
ATGAGTAACCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGACCGTCCCTACCAGTCGG
CCGAGCCCGCAGCGCAGCGCACCTGCTCGCTGGCCGAGTACAAGGCCAGCATCGTCCGCGACCTCGAAGT
CCTGGTGAACACCCGCCAGTCCCTGGTCGCCGAAGAGCTCGACGGTTTCAGCCAGCTCGGTGGTTCCATC
CTTGAATACGGCATGCCGGACTTCATCAGCCGCAGCGTGCTCGACCCGCACGATCGTCGCCTGATCCAGC
AACAGCTGGAGCGGGCGATCAGCACCGGAGACCGGCGCTTTCGCCGGGTCCGTGTTCAGCTGTTGGCCCA
GCAGAACGGCCACCGCATGTTGACCTTCCGCGTGGACGCCGTGTTGCGTCTGCAGGACATCAGCCGCCAG
GTGTCATTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA