SecReT6
Protein ID: 395449308
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10469
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5598401..5599903 [-]
Producthypothetical protein
NoteTssC
UniProt IDI3V3X5
KEGG IDppi:YSA_10469
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-196, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|395449308|ref|YP_006389561.1| hypothetical protein YSA_10469 [Pseudomonas putida ND6]
MTDKQTAPQQAGDLVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIA
VLDSRIAEIDAMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASE
FDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASSELFGWDSF
TEMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQGARG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5599903-5598401 Pseudomonas putida ND6 chromosome, complete genome
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGACCTGGTCGAAGTGGAAAACTTCGCGCCACAGC
CCTCGCTGCTCGACAGCATCATTTCGCAAAGCCGTGTGGCCCGCTCCGACACCGAGCGCAACCGCACCCG
CGACCTGATTGGCGAACTGGTGAACCAGGTGCTCGAGGGTGAGATGACCCCGAGCAAGGACCTGATCGCC
GTGCTCGATTCGCGAATCGCCGAGATCGACGCGATGCTCTCCGAGCAGATGAACGAGATCATGCACGCCC
GCGAGTTCCAGCAGTTGGAAGCCTCCTGGCGCGGCCTGAAATACCAGGTGGACCAGACCGAGACCAGCAC
CACGCTGAAGATCCACCTGCTCAATGCCTCGAAAAAAGACCTGGTACGCGACCTGAAGGCTGCCAGCGAG
TTCGACCAGAGCGCGCTGTTCAAGAAGGTCTACGAAGAAGAGTACGGCACCTTCGGTGGCGCACCTTTCG
GCATGTTGATCGGTGACTACGAGTTCAACCGCAACCCCGAAGACATGTACCTGCTCGAAGAGATCTCGCA
CGTCGCGGCGGCGGCGCACGCGCCGTTCATCTCGGCCGCTTCGTCCGAGCTGTTCGGCTGGGACTCGTTC
ACCGAGATGTCCGGCCCGCGTGACCTGGCGAAGATCTTCGACACCGTGGAATACGCCAAGTGGAAGTCGT
TCCGCGCCTCGGAAGACTCGCGCTACGTCGGCCTCACCCTGCCCCACGTGCTCGGTCGTCTGCCGTATGG
CCCGGATACCACGCCAGTGGAAGAATTCAACTTCGTCGAAAGCGTCGATGGCCGCGACCACAACAAGTAC
CTGTGGATGAACGCCGCCTACGCCCTCGGCACCCGCGTCACCGACGCCTTCGCCCGCTACGGCTGGTGCG
TGGCCATCCGCGGCGTGGAAGGCGGCGGCCTGGTCGAAGGCCTGCCGACCCATACCTTCAAGACCGACGA
CGGCGAAATCGCCCTCAAGTGCCCGACCGAAATCGCCATCACCGACCGCCGCGAAAAAGAGCTGTCGGAC
CTGGGCTTCATCCCCCTGGTGCACTGCAAGGGCACCGACTATGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAACAGAAGCAGTACAACACCGACATCGCCAACGCCAACGCACGCCTGTCGGCCCAGTTGCAATACAT
CTTCGCCACTTCGCGCATCGCCCACTACATGAAGGCGATCATGCGCGACAAGATCGGCAGCTTTGCCTCG
CGCATGGATGTCGAGCGCTTCCTCAACCAGTGGCTGGCCAGCTATGTGCTGCTCGACGATACCGCCAGCC
AGGAGGCCAAGGCCAAGTTCCCGCTGCGTGAAGCCCGCGCCGAGGTGTTCGAAGTGCCCGGCAAGCCAGG
CGTGTACAAGGCCGTGACCTACTTGCGCCCGCACTACCAGCTGGATGAGCTGACCGCCTCGCTGCGGCTG
GTTGCCGAGCTGCCACAGGGCGCGCGCGGCTGA