SecReT6
Protein ID: 395449309
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10471
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5599918..5600493 [-]
Producthypothetical protein
NoteTssB
UniProt IDI3V3X6
KEGG IDppi:YSA_10471
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-60, Aligned region: 2..25
DUF770 [PF05591], Evalue: 1.30E-60, Aligned region: 23..177
Protein Sequence: 191 a.a.     [Download]
>gi|395449309|ref|YP_006389562.1| hypothetical protein YSA_10471 [Pseudomonas putida ND6]
MIRSELLALENTMAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLK
DRKFVYIDRDNFNGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPLRKLLEVRN
KLADLRNKMGGNDKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSDDRA
 
Nucleotide Sequence: 576 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5600493-5599918 Pseudomonas putida ND6 chromosome, complete genome
ATGATTCGCAGCGAATTGCTCGCACTGGAGAACACGATGGCGAAGAAGGAAAGCACTCAGCACAAACTCG
ACCGCGTTCGCGCGCCTCGGGTCCATATCACCTACGACGTGGACATCGGCGATGCCATCGAGAAAAAGGA
GCTGCCCTTCGTCGTCGGCGTACTGGGTGATTTCTCCGGCAACCCGCTGGAGCCGCTGCCCAAGCTCAAG
GACCGCAAGTTCGTGTACATCGACCGCGACAACTTCAACGGTGTGCTCAAGGGCATCAAGCCACGCCTGA
CCTACCGCGTCGACAACACCCTGGCCAAGAACGGTACCCAGTTGGGCGTGGAGCTGAACTTCAACAGCCT
CGAAGATTTCGAGCCACAGAACGTGGTCAAGCAGGTCGAGCCGCTGCGCAAGCTGCTGGAGGTGCGCAAC
AAGCTGGCCGACCTGCGCAACAAGATGGGCGGCAACGACAAGCTCGAAGAGCTGCTGATGGACGTGCTGC
AGAACACCGAAAAGCTCAAGACCTTGGGCAAGGAATTCGGCCGTGAAGCCGAAGTTAAAGACCCGTCCAG
CGACGATCGCGCCTGA