SecReT6
Protein ID: 395449314
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10485
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5602742..5605186 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDI3V3Y1
KEGG IDppi:YSA_10485
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.60E-80, Aligned region: 234..543
Phage_base_V [PF04717], Evalue: 1.50E-23, Aligned region: 577..670
Gp5_C [PF06715], Evalue: 8.10E-06, Aligned region: 721..743
Gp5_C [PF06715], Evalue: 8.10E-06, Aligned region: 749..761
DUF2345 [PF10106], Evalue: 0.00071, Aligned region: 760..808
Protein Sequence: 814 a.a.     [Download]
>gi|395449314|ref|YP_006389567.1| Rhs element Vgr protein [Pseudomonas putida ND6]
MKAIEHRCTVSWLAASRKCHYGRVRDGHLPELASGEKFEPIHVMKHFSPPVELMRQVARQFEWELSGMGA
DRHLKNLLRRAVRRLPGALPGASEEDEGWRYDIALQGGIARFSWACSELTGQLMPVFPLGLSACLAFGNV
NPVAFISMHDGTFLSAGSRMIPQARALCAHAEYARKIRVAAEHRKRVLAVFSRRFRMIMDLASALLSPQN
RRLFKFHNLANPEQELLLETFKGTEALSRAFNYELLLVCEDSGVPLKSMMGQHVSIEIELAEGGPRYITG
YLTRFASIGSDGGMARYTATLNPWFSMLKNRFDTRIFQGNTVEEVVTEVFALCPAFSRHEFRLTRPQKRY
TYITQYRETDFNFVQRLLEEEGMFYYFEHTAEGHTMIICDDSSTLVAIPEQPQIRFHSASVTETADSITQ
WSGNRQLQSGKMATQTFDYRQPNNRLPVALNSVNNQGDVENFEIYDFPGQYTHGTYDEGETLLRLRIEAL
ELRGKKFEGASNCRAMKPGYTFELLQHYIHDQGPVEDRQFLLMSVESEGHNNYLTGQQASYFNTFSCVRK
KIPFRPQLSTPKPTIAGPQTAIIVGPPGEEIFTDELGRVKIQFHWDRNGKYNDHSSCWVRVAQSGASGGF
GSIQIPRVGDEVVVVFLDGNPDRPLIMGSLYNSTNTPPWSLPANKTQSGFLTRSMKGDGGTANFFRFEDK
AGAEQIIMHAERNMDTEIELDETHDVGNNRSITVGGTHTETVKKDTVVQVTEGSYTLQVDNQFIQVAAKQ
HIILQVGDSSITLTPEGIEIKGKVIVTTSTDTTQITGAAVRIND
 
Nucleotide Sequence: 2445 bp     [Download]
>gi|395443650|ref|NC_017986.1|:5602742-5605186 Pseudomonas putida ND6 chromosome, complete genome
ATGAAGGCAATTGAGCATCGCTGCACGGTTTCGTGGCTGGCCGCATCCCGCAAGTGCCATTACGGCCGCG
TTCGCGATGGCCATTTGCCGGAATTGGCCAGTGGCGAAAAATTTGAACCAATCCACGTTATGAAACATTT
TTCTCCGCCAGTGGAGCTGATGCGTCAGGTAGCGAGACAGTTCGAGTGGGAGCTGTCAGGCATGGGCGCT
GATCGACACCTCAAGAACCTTCTACGACGGGCCGTTCGGCGATTGCCGGGGGCGCTTCCGGGCGCCAGTG
AGGAAGATGAGGGGTGGCGATATGACATTGCCTTGCAGGGCGGTATTGCCCGGTTTTCCTGGGCCTGTAG
TGAGTTGACAGGGCAGCTTATGCCGGTGTTTCCTTTGGGCCTTTCTGCCTGCCTGGCATTCGGAAATGTG
AACCCTGTCGCATTTATTTCAATGCATGATGGCACTTTCCTTTCTGCAGGCAGTCGCATGATTCCGCAAG
CACGCGCGTTATGCGCGCATGCAGAATACGCCCGCAAGATCAGGGTTGCAGCTGAGCATCGCAAGCGCGT
GCTGGCCGTGTTTTCAAGGAGATTTCGCATGATCATGGACTTGGCCTCCGCGCTGCTGTCGCCACAGAAC
CGCCGCCTGTTCAAGTTTCACAACCTCGCCAACCCCGAGCAGGAGCTGCTGCTGGAAACCTTCAAGGGCA
CCGAAGCCCTGTCGCGGGCGTTCAACTACGAACTGCTGCTGGTCTGCGAAGACTCCGGCGTGCCGCTCAA
ATCCATGATGGGCCAGCACGTCAGCATCGAGATCGAACTGGCCGAAGGCGGCCCGCGGTACATAACCGGC
TACCTCACACGCTTTGCCAGCATCGGCAGCGACGGCGGCATGGCACGCTATACCGCCACCCTCAACCCGT
GGTTCTCGATGCTGAAGAACCGCTTCGACACGCGGATCTTCCAGGGCAACACGGTCGAGGAAGTGGTTAC
CGAAGTGTTCGCCCTGTGCCCGGCGTTTTCCCGCCACGAGTTTCGCCTGACCCGGCCACAGAAGCGCTAC
ACCTACATCACCCAGTACCGCGAAACCGACTTCAACTTCGTCCAGCGCCTGCTGGAGGAAGAGGGGATGT
TCTACTACTTCGAGCACACCGCCGAAGGCCACACCATGATCATCTGCGATGACTCCAGCACGCTGGTGGC
CATCCCCGAGCAACCGCAAATCCGCTTCCACAGCGCCTCCGTCACCGAGACCGCCGACTCCATCACCCAG
TGGAGCGGCAACCGTCAACTGCAATCCGGCAAGATGGCCACGCAAACCTTTGACTACCGCCAACCGAACA
ACCGCCTGCCGGTGGCGCTGAACAGCGTGAACAATCAGGGCGATGTCGAGAACTTCGAGATCTACGACTT
CCCCGGCCAGTACACCCACGGTACCTATGACGAAGGCGAAACCCTGCTGCGCCTGCGCATTGAGGCGCTG
GAGCTGCGCGGCAAAAAGTTTGAAGGCGCCAGCAACTGCCGGGCCATGAAGCCGGGCTACACCTTCGAAC
TGCTGCAGCACTACATCCACGACCAGGGGCCGGTAGAAGACCGTCAGTTCCTGCTGATGAGCGTGGAAAG
CGAAGGCCACAACAACTACCTTACCGGCCAGCAGGCCAGCTACTTCAACACCTTCAGTTGCGTGCGCAAG
AAGATCCCGTTCCGCCCGCAACTGAGTACGCCCAAACCGACCATTGCCGGCCCGCAGACCGCGATCATCG
TCGGCCCACCGGGTGAGGAGATCTTCACCGACGAACTGGGCCGGGTGAAAATCCAGTTCCACTGGGACCG
CAATGGCAAGTACAACGACCACAGCTCGTGCTGGGTACGTGTCGCCCAGTCCGGTGCCAGCGGTGGCTTC
GGTAGCATCCAGATTCCGCGCGTAGGCGACGAAGTGGTGGTGGTGTTCCTCGACGGCAACCCGGACCGGC
CGCTGATCATGGGCAGCCTGTACAACAGCACCAACACCCCGCCATGGTCGCTGCCGGCGAACAAGACCCA
GAGTGGGTTCCTGACGCGGTCGATGAAGGGCGACGGCGGTACCGCCAACTTCTTCCGCTTCGAGGACAAG
GCCGGCGCCGAGCAGATCATCATGCATGCCGAGCGCAACATGGATACCGAGATCGAGCTGGATGAGACCC
ATGATGTGGGGAATAACCGCTCGATTACTGTTGGTGGTACGCACACCGAAACGGTCAAGAAAGACACCGT
GGTGCAGGTGACCGAAGGTTCCTACACCCTGCAGGTCGACAACCAGTTCATCCAGGTGGCCGCCAAGCAG
CACATCATCCTGCAGGTGGGCGACAGCAGCATCACGCTGACCCCGGAAGGCATCGAGATCAAAGGCAAGG
TCATCGTGACCACCAGTACCGACACCACCCAGATCACCGGCGCCGCAGTGCGGATCAACGACTGA