SecReT6
Protein ID: 397657639
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2626
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2770900..2771391 [+]
Producthypothetical protein
NoteTssB
UniProt IDI6WP45
KEGG IDkoe:A225_3380, koe:A225_2626
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-52, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|397657639|ref|YP_006498341.1| hypothetical protein A225_2626 [Klebsiella oxytoca E718]
MADTFQNEVPKARINLKLALHTGGAQKKVELPLKLLTIGDFSNGKEDRPLSERAKINVNKNNFNSVLSEF
SPEISLTVQNTLAGDSAEENIQLRFADMKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EKILKDPALTQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2770900-2771391 Klebsiella oxytoca E718 chromosome, complete genome
ATGGCTGATACGTTCCAGAATGAGGTGCCCAAGGCACGCATTAATTTAAAGCTGGCTCTGCACACAGGAG
GCGCGCAGAAGAAAGTCGAGCTGCCGCTGAAACTCCTCACCATCGGTGATTTCAGTAATGGCAAAGAAGA
CCGGCCATTATCGGAAAGAGCAAAAATCAACGTCAATAAAAATAACTTCAACAGCGTACTTTCGGAATTC
AGCCCGGAAATCAGCCTCACGGTACAGAACACGCTGGCCGGCGATAGCGCCGAAGAAAATATTCAGCTCC
GCTTCGCCGATATGAAAGATTTCGAACCGGAGCAGGTGGCCCGCCAGATCCCCCAGCTCCGCGCCATGCT
GGCGATGCGGAATTTATTACGCGACCTCAAATCCAACCTCCTTGATAACGCCACTTTCAGAAAAGAGCTT
GAGAAAATCCTGAAAGACCCGGCACTGACGCAGGAATTACGCGACGAAATGAGCGCGCTGGCCCCGAAAT
AA