SecReT6
Protein ID: 397657640
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2627
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2771426..2772967 [+]
Producthypothetical protein
NoteTssC
UniProt IDI6W590
KEGG IDkoe:A225_2627
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.60E-172, Aligned region: 87..509
Protein Sequence: 513 a.a.     [Download]
>gi|397657640|ref|YP_006498342.1| hypothetical protein A225_2627 [Klebsiella oxytoca E718]
MLMSVNTETAPAQGQTAVLEKESVYASLFDKINLTPASRLGDINDFLDDAALSDAPAGERLTAAMQVFMD
CIRQSGKTVEKLDKTLIDHHIAELDYQISRQLDAVMHHPEFQKVESLWRGLKQLVDSTDYRQNVKTEILD
VSKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISGVSAAAHMP
FIGAVGPAFFLKESMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDARYIGLVMPRVLGRLPYGPDTVPVRS
FNYVEQVKGPDHEKYLWTSASFSFASNMVKSFINNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKLVQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLYAV
PHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2771426-2772967 Klebsiella oxytoca E718 chromosome, complete genome
ATGCTGATGTCTGTAAATACTGAAACCGCCCCCGCGCAGGGGCAGACCGCTGTACTGGAAAAAGAGAGCG
TTTACGCCTCCCTGTTTGACAAAATCAACCTGACCCCGGCTTCCCGCCTGGGAGATATTAACGACTTTCT
GGATGATGCCGCGCTGTCCGACGCCCCGGCGGGCGAACGACTGACGGCGGCGATGCAGGTGTTTATGGAC
TGCATCCGTCAGTCCGGAAAGACCGTGGAGAAGCTCGACAAGACCCTGATTGACCACCATATCGCTGAAC
TGGACTATCAAATCAGCCGCCAGCTGGACGCGGTGATGCACCATCCTGAGTTCCAGAAGGTGGAATCCCT
GTGGCGCGGCCTGAAGCAGCTGGTGGACAGCACCGACTACCGCCAGAACGTCAAAACCGAAATTCTGGAT
GTCTCCAAAGACGATCTGCGCCAGGACTTCGAAGACGCGCCGGAGCTGATTCAGAGCGGTCTCTACTGGC
ACACCTACACCGCCGAGTACGACACCCCGGGCGGCGAGCCGATTGGCTCGGTGATCTCCGCGTATGAGTT
CGACGCCAGCCCGCAGGACGTGGCGCTGCTGCGCAACATCTCCGGCGTCTCCGCCGCGGCCCATATGCCG
TTTATCGGTGCCGTCGGCCCGGCCTTCTTTCTGAAAGAGTCCATGGAAGAGGTTGCCGCCATCAAGGATA
TCGGCAACTACTTCGACCGCGCCGAGTACATCAAATGGAAATCCTTTCGCGACACCGACGACGCGCGCTA
TATCGGCCTGGTGATGCCGCGCGTGCTGGGCCGCCTGCCGTATGGTCCGGACACCGTGCCGGTGCGCAGC
TTCAACTACGTCGAGCAGGTGAAAGGCCCGGACCATGAGAAATACCTGTGGACCAGCGCCTCGTTCTCCT
TCGCGTCCAATATGGTGAAAAGCTTTATTAATAACGGCTGGTGCGTGCAGATCCGTGGCCCGCAGGCGGG
CGGAGCGGTGAAAGATCTGCCGATCCACCTCTACGATCTGGGCACAGGCAACCAGGTGAAGATCCCGTCG
GAGGTGATGATCCCGGAAACCCGCGAGTTTGAGTTCGCCAGCCTCGGCTTTATCCCGCTGTCGTACTACA
AAAACCGCGACTATGCCTGCTTCTTCTCGGCCAACTCCGCCCAGAAGCCGGCGCTGTACGACACCGCCGA
CGCCACCGCCAACAGCCGCATCAACGCCCGTCTGCCGTATATCTTCCTGCTGTCGCGTATTGCGCACTAC
CTGAAGCTCGTTCAGCGTGAAAACATCGGCACCACCAAGGATCGCCGCCTGCTGGAGCTGGAGCTCAACA
CCTGGGTGCGCGGTCTGGTGACGGAGATGACCGACCCGGGCGACGAGCTGCAGGCCTCACACCCGCTGCG
CGACGCGAAGGTGGTGGTGGAAGATATCGAGGACAATCCGGGCTTCTTCCGCGTGAAGCTGTACGCGGTG
CCGCACTTCCAGGTGGAAGGGATGGACGTGAACCTGTCTCTGGTTTCTCAGATGCCGAAAGCGAAAGCGT
AA