SecReT6
Protein ID: 397657641
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2628
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2772981..2774324 [+]
Producthypothetical protein
NoteTssK
UniProt IDI6X248
KEGG IDkoe:A225_2628
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.70E-132, Aligned region: 18..444
Protein Sequence: 447 a.a.     [Download]
>gi|397657641|ref|YP_006498343.1| hypothetical protein A225_2628 [Klebsiella oxytoca E718]
MKTVRPLWGRGQMVSPQHFQQEAAQAAWHTECVARLGAIHPWGVARTAFDAALLKQGKLKADHLCVRFAD
GTLTDSDNADALPPVMTLPETESHELTVVLALPHEYENGGNCLQPEQKAERPVRWRLAWREVRNRYGDDS
RQIAVMQPELTLRTDDNDNGNYQTVAVARLKRDSQGDWSQDASFIPPLLNVQASRWLTEQTEYLTGQLRA
RLQRLMSMRRESNERMADFAVADVSLFWLLNALNSAEPVLSHLVRYPQVHPERLYQALAGLAGSLLTFSL
DHTTADIPAYRHEQLTAVFPPLFDLLGVLLEASLPSRVVAIDMVRDERRKRWHARLHDPRLREEADFYLS
VRSPLPVAQLLEQFPLQCKAGSPDEVDRVVNGSQPGIPLRAMSHVPAAIPLRLENQYFTLDMAHPAARAM
LLEGSCVFYVPGLLGDPELELFAVLRS
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2772981-2774324 Klebsiella oxytoca E718 chromosome, complete genome
ATGAAAACAGTACGACCGCTGTGGGGGCGGGGCCAGATGGTTTCCCCTCAACATTTTCAGCAGGAGGCCG
CGCAAGCGGCCTGGCACACCGAGTGTGTCGCCCGACTGGGAGCAATACATCCCTGGGGGGTTGCGCGGAC
GGCTTTTGACGCCGCGCTGCTGAAACAGGGGAAGCTGAAGGCCGACCACCTGTGCGTGCGTTTCGCTGAC
GGAACGCTCACTGATAGCGATAACGCCGATGCGTTGCCGCCCGTGATGACCTTACCGGAAACAGAAAGCC
ACGAACTGACGGTGGTTTTGGCGCTGCCCCATGAGTATGAAAACGGCGGCAACTGCCTGCAACCGGAGCA
GAAAGCGGAGCGTCCTGTGCGCTGGCGTCTGGCCTGGCGGGAGGTGCGTAACCGCTATGGGGATGACAGC
CGCCAGATTGCGGTAATGCAGCCGGAGCTGACGCTGCGTACAGACGATAACGACAACGGCAATTACCAGA
CCGTCGCCGTGGCCCGTCTTAAGCGCGACAGCCAGGGAGACTGGTCGCAGGACGCGTCGTTTATCCCGCC
GCTGCTGAACGTGCAGGCCAGCCGCTGGCTAACGGAGCAGACCGAATATCTGACGGGTCAGCTACGCGCG
CGCCTGCAGCGCCTGATGTCTATGCGCCGGGAGAGCAACGAACGGATGGCCGACTTCGCGGTGGCGGACG
TGTCGCTGTTCTGGCTGCTGAATGCGCTCAACAGCGCTGAGCCGGTGCTGAGCCATTTGGTGCGCTATCC
GCAGGTGCACCCGGAGCGGCTTTATCAGGCGCTGGCCGGTCTTGCAGGCAGCCTGCTGACGTTTTCTCTT
GATCACACCACCGCCGATATTCCGGCCTATCGTCATGAGCAGCTAACGGCGGTCTTCCCGCCGTTGTTTG
ACCTACTGGGTGTGCTGCTGGAAGCCAGCCTGCCGTCGCGGGTCGTGGCGATTGACATGGTCCGCGATGA
GCGGCGCAAGCGCTGGCACGCCCGTCTCCACGATCCGAGACTGCGTGAAGAGGCGGATTTTTATCTCTCG
GTACGCTCGCCGCTGCCGGTAGCGCAACTGCTGGAGCAGTTTCCGCTTCAGTGCAAAGCGGGTAGCCCGG
ATGAAGTCGACAGGGTGGTCAATGGTTCCCAGCCCGGCATTCCTTTGCGCGCGATGAGCCACGTCCCTGC
GGCTATCCCGCTGCGCCTGGAAAACCAGTATTTCACCCTTGATATGGCCCATCCGGCGGCGCGGGCGATG
CTGCTGGAAGGCAGTTGTGTCTTTTACGTCCCCGGTCTGCTGGGCGATCCGGAACTTGAACTGTTTGCGG
TGCTGCGCTCATGA