SecReT6
Protein ID: 397657642
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2629
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2774321..2774986 [+]
Producthypothetical protein
NoteTssL
UniProt IDI6VUP6
KEGG IDkoe:A225_2629
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-39, Aligned region: 7..208
Protein Sequence: 221 a.a.     [Download]
>gi|397657642|ref|YP_006498344.1| hypothetical protein A225_2629 [Klebsiella oxytoca E718]
MKQDINIDALMADAWLTVTELRFGARLADGEGDRLWRHCVDHIEQVMAKLEAADVSEASRRHILYAWCAL
LDETAKGREGEDDACIVWYDRPLQAKYFGALDAGDALYERMRQVLREPAPDMVVLTCFHRVLMLGFKGCY
ALNEPARDQLVRVLTERVPPFETDQSRPVLAGISGRSGLADGLRRWPVCIGLSLVAIAALWWGLNHWLDS
LIATLLPGAGK
 
Nucleotide Sequence: 666 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2774321-2774986 Klebsiella oxytoca E718 chromosome, complete genome
ATGAAACAGGACATAAATATCGACGCCCTGATGGCGGACGCGTGGCTGACGGTGACAGAACTGCGGTTCG
GCGCAAGACTGGCCGACGGGGAGGGCGACCGCCTGTGGCGACATTGTGTAGATCATATTGAACAGGTGAT
GGCGAAGCTCGAGGCTGCGGACGTCAGCGAGGCGAGCCGTCGGCATATTCTCTACGCCTGGTGTGCGCTG
CTGGATGAGACCGCCAAAGGACGCGAAGGCGAGGATGATGCCTGCATCGTCTGGTATGACCGTCCGCTGC
AGGCGAAATACTTTGGTGCTCTGGACGCCGGAGATGCTTTGTATGAACGGATGCGACAGGTTCTGCGCGA
GCCCGCGCCGGATATGGTGGTGCTGACCTGTTTCCACCGGGTGCTGATGCTCGGCTTTAAAGGGTGTTAT
GCCCTGAATGAACCGGCTCGTGACCAGCTTGTTCGGGTACTGACCGAGCGCGTGCCGCCGTTTGAAACGG
ACCAGAGCCGTCCCGTACTGGCGGGTATCTCCGGGCGCAGCGGCCTGGCGGACGGGTTACGTCGCTGGCC
GGTTTGCATCGGGCTGTCGCTGGTAGCGATCGCCGCGCTGTGGTGGGGTCTGAACCACTGGCTTGATTCC
CTGATTGCAACCCTGCTGCCGGGGGCCGGGAAATGA