SecReT6
Protein ID: 397657643
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2630
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2774989..2776671 [+]
Producthypothetical protein
NoteTagL
UniProt IDI6WZ42, I6WZ42
KEGG IDkoe:A225_2630
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.80E-15, Aligned region: 146..156
OmpA [PF00691], Evalue: 2.80E-15, Aligned region: 436..531
Protein Sequence: 560 a.a.     [Download]
>gi|397657643|ref|YP_006498345.1| hypothetical protein A225_2630 [Klebsiella oxytoca E718]
MRYLRLLWLWGGILALLLCLLFLPLASGGRILAAALILAAVIAGLIFAGRRREDPLVDNAWLDEIPDAPY
RLPVVLVCGDIAGWPESGPVYRTARGCWLNVPTAELQQTVRILLWKRPDLVSQLAVMVSVCPQLHRDEAA
LAAGLYELRWQLSQVRSDCRRAVPLLLNSKVAGASVPQPLWQTAQAGEAMQVWLADDVPCSTGTWLAQKD
GTDRLAAQVRMNTLVRLTEQTMMAALTAASDDMPPADPAMVVYRMTPSGAPVLADSLWQRWLSQHTALNS
LPGWQPEPSSADVTLPNFILPLLPLGAGVTPLSRTLRRAFCLFTLAAIIALCASAWNNRQLLQRVGFDIQ
HYAQIAMDDYAPKARAVQILRGDALQLDRWARHGEPLEMGLGLYHGEHLRMPVLDAIRSYVPPPPPLKPA
EKTASKIIRLDSMSLFDTGRWALKPGSTKLLVNSLVGIKAKPGWLIVVAGHTDSTGDDKSNQILSLKRAE
SVRDWMRDTGDVPESCFAVQGYGESRPVAPNDTVEGRALNRRVEISLVPQANACQPPGMTPAPSQDDGAF
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2774989-2776671 Klebsiella oxytoca E718 chromosome, complete genome
GTGCGCTATTTGCGCCTGTTATGGCTCTGGGGCGGGATCCTGGCGCTGCTGCTCTGCCTGCTGTTTCTGC
CGCTGGCCTCCGGCGGGCGGATTCTGGCCGCTGCGCTGATACTGGCCGCCGTTATCGCCGGGCTGATTTT
CGCCGGGCGCAGGCGGGAAGATCCGCTGGTAGATAACGCCTGGCTGGATGAGATACCGGACGCGCCGTAT
CGCCTGCCGGTGGTGCTGGTCTGCGGTGATATCGCCGGGTGGCCGGAGAGCGGGCCAGTTTACCGCACGG
CACGGGGCTGCTGGTTAAACGTCCCGACGGCTGAACTGCAGCAGACGGTACGTATTCTTCTGTGGAAACG
CCCGGACCTCGTATCGCAGCTGGCGGTGATGGTCAGCGTCTGTCCGCAGCTGCATCGTGATGAGGCGGCG
CTGGCGGCCGGGCTTTATGAGCTGCGCTGGCAGCTGAGCCAGGTGCGGAGCGATTGCCGCCGGGCGGTGC
CTTTACTGTTGAACAGTAAGGTGGCGGGGGCGTCTGTTCCACAACCGCTGTGGCAGACAGCGCAGGCCGG
GGAGGCCATGCAGGTATGGCTGGCGGACGATGTGCCGTGCAGCACCGGGACATGGCTGGCGCAAAAGGAC
GGGACGGACCGCCTGGCTGCGCAGGTGAGGATGAATACGCTGGTTCGCCTGACTGAACAAACAATGATGG
CCGCGCTGACGGCGGCGTCGGACGATATGCCTCCGGCGGACCCGGCGATGGTGGTATATCGCATGACGCC
TTCGGGGGCGCCGGTTCTGGCTGATAGCCTGTGGCAGCGCTGGTTGTCTCAACATACTGCCCTGAATTCG
CTGCCCGGCTGGCAGCCCGAACCCTCATCAGCGGATGTCACGCTGCCGAATTTTATTCTGCCGCTGTTGC
CACTGGGCGCCGGCGTGACGCCGCTCAGCAGAACTTTACGGCGGGCATTCTGCCTGTTCACCCTTGCCGC
CATCATCGCACTGTGCGCCAGCGCGTGGAACAACCGCCAGCTGCTGCAGCGGGTGGGGTTCGATATTCAG
CATTACGCGCAGATTGCGATGGATGACTACGCCCCGAAAGCCCGCGCCGTGCAGATCCTGCGCGGGGATG
CGCTGCAGCTGGATCGGTGGGCGCGCCACGGTGAACCGCTGGAAATGGGGCTCGGCCTGTATCACGGGGA
GCATTTGCGCATGCCGGTGCTTGACGCCATTCGTTCCTATGTCCCGCCGCCTCCGCCACTGAAGCCTGCC
GAGAAAACCGCGTCGAAAATCATCCGCCTCGACAGCATGTCGCTGTTCGACACCGGCAGGTGGGCGCTGA
AGCCCGGCTCGACAAAGCTGCTGGTGAACTCGCTGGTCGGCATTAAAGCGAAGCCCGGCTGGCTGATTGT
GGTGGCGGGCCATACCGACAGCACCGGCGACGATAAATCCAACCAGATACTTTCGCTTAAGCGTGCCGAA
TCGGTGCGCGACTGGATGCGCGACACCGGCGACGTGCCGGAGAGCTGTTTCGCGGTGCAGGGCTACGGCG
AGAGCCGACCCGTTGCCCCCAACGACACGGTCGAAGGCCGGGCGCTGAACCGCCGTGTCGAAATCAGTCT
GGTGCCGCAGGCGAATGCCTGCCAGCCACCGGGCATGACCCCCGCGCCATCGCAGGATGATGGCGCTTTT
TAA