SecReT6
Protein ID: 397657646
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2633
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2777554..2778141 [+]
ProductclpB protein
NoteTssH
UniProt IDI6X253
KEGG IDkoe:A225_2633
PDB IDNA
Domain hit(s) vs Pfam Clp_N [PF02861], Evalue: 2.80E-06, Aligned region: 22..63
Clp_N [PF02861], Evalue: 2.80E-06, Aligned region: 105..123
Protein Sequence: 195 a.a.     [Download]
>gi|397657646|ref|YP_006498348.1| clpB protein [Klebsiella oxytoca E718]
MENPAILLRRLNPYCARAMEGAATLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDAIWQDLL
TFMDKLPRSVRGRPQLSDAIQTLMQEAWLSASLAGEEHIRSIHLLMALVDKQSLVRCDGLWPLLTLAQSQ
LARLRPLLDAQSEERPEVQQEAELAQGDEVAFVGRPVNAGVKEGGSESGSAECAG
 
Nucleotide Sequence: 588 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2777554-2778141 Klebsiella oxytoca E718 chromosome, complete genome
ATGGAAAATCCCGCCATTTTGTTACGCCGTCTTAATCCTTACTGCGCCCGTGCGATGGAAGGCGCTGCCA
CCCTGTGCCAGACCCGGGCGCACGCGGAAATCCTGCCCGAGCACTGGCTGCTGAAACTGCTGGAGCAGGG
CGAGGGCGACCTGACGGTACTGGCGCGGCGCTACGAATGGGATATGGACGCGATATGGCAGGATTTGCTG
ACCTTTATGGATAAGCTCCCCCGTTCGGTGCGCGGCCGCCCGCAGCTTTCAGACGCTATTCAGACTCTGA
TGCAGGAGGCATGGCTAAGCGCTTCGCTGGCCGGGGAGGAGCATATCCGTAGTATCCACCTGCTGATGGC
GCTGGTGGATAAACAGAGTCTGGTGCGCTGCGACGGCCTGTGGCCGCTGCTGACCCTGGCGCAGAGCCAG
CTGGCGCGCCTGCGTCCGCTGCTGGACGCGCAGTCCGAAGAGCGCCCGGAGGTGCAGCAGGAAGCAGAGC
TGGCGCAGGGCGACGAGGTGGCGTTTGTCGGCCGTCCGGTTAATGCGGGCGTAAAAGAAGGGGGATCTGA
ATCCGGCTCTGCAGAATGCGCTGGATAA