SecReT6
Protein ID: 397657647
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2634
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2778155..2780197 [+]
ProductclpB protein
NoteTssH
UniProt IDI6VUQ0
KEGG IDkoe:A225_2634
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.30E-40, Aligned region: 34..53
AAA_2 [PF07724], Evalue: 1.30E-40, Aligned region: 408..573
AAA [PF00004], Evalue: 4.20E-19, Aligned region: 36..148
AAA [PF00004], Evalue: 4.20E-19, Aligned region: 413..539
AAA [PF00004], Evalue: 4.20E-19, Aligned region: 561..578
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 13..57
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 81..115
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 253..308
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 381..449
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 476..506
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 551..595
ClpB_D2-small [PF10431], Evalue: 4.00E-14, Aligned region: 181..204
ClpB_D2-small [PF10431], Evalue: 4.00E-14, Aligned region: 381..401
ClpB_D2-small [PF10431], Evalue: 4.00E-14, Aligned region: 579..653
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 36..56
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 110..166
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 412..531
AAA_25 [PF13481], Evalue: 3.00E-09, Aligned region: 36..111
AAA_25 [PF13481], Evalue: 3.00E-09, Aligned region: 160..182
AAA_25 [PF13481], Evalue: 3.00E-09, Aligned region: 408..441
AAA_19 [PF13245], Evalue: 5.90E-09, Aligned region: 33..57
AAA_19 [PF13245], Evalue: 5.90E-09, Aligned region: 408..435
AAA_22 [PF13401], Evalue: 6.80E-09, Aligned region: 35..121
AAA_22 [PF13401], Evalue: 6.80E-09, Aligned region: 170..196
AAA_22 [PF13401], Evalue: 6.80E-09, Aligned region: 409..433
AAA_22 [PF13401], Evalue: 6.80E-09, Aligned region: 473..506
Arch_ATPase [PF01637], Evalue: 6.00E-07, Aligned region: 14..51
Arch_ATPase [PF01637], Evalue: 6.00E-07, Aligned region: 88..186
Arch_ATPase [PF01637], Evalue: 6.00E-07, Aligned region: 277..297
Arch_ATPase [PF01637], Evalue: 6.00E-07, Aligned region: 405..433
IstB_IS21 [PF01695], Evalue: 7.10E-07, Aligned region: 30..96
IstB_IS21 [PF01695], Evalue: 7.10E-07, Aligned region: 412..432
AAA_17 [PF13207], Evalue: 4.50E-06, Aligned region: 36..101
AAA_17 [PF13207], Evalue: 4.50E-06, Aligned region: 411..449
Zeta_toxin [PF06414], Evalue: 5.10E-06, Aligned region: 30..60
Zeta_toxin [PF06414], Evalue: 5.10E-06, Aligned region: 402..452
NACHT [PF05729], Evalue: 2.00E-05, Aligned region: 36..63
NACHT [PF05729], Evalue: 2.00E-05, Aligned region: 412..436
AAA_18 [PF13238], Evalue: 5.40E-05, Aligned region: 36..56
AAA_18 [PF13238], Evalue: 5.40E-05, Aligned region: 413..442
Sigma54_activat [PF00158], Evalue: 0.00012, Aligned region: 19..50
Sigma54_activat [PF00158], Evalue: 0.00012, Aligned region: 411..529
AAA_23 [PF13476], Evalue: 0.00013, Aligned region: 36..52
AAA_23 [PF13476], Evalue: 0.00013, Aligned region: 240..333
AAA_23 [PF13476], Evalue: 0.00013, Aligned region: 409..436
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 30..52
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 408..435
RNA_helicase [PF00910], Evalue: 0.00059, Aligned region: 37..58
RNA_helicase [PF00910], Evalue: 0.00059, Aligned region: 413..434
RNA_helicase [PF00910], Evalue: 0.00059, Aligned region: 510..531
AAA_14 [PF13173], Evalue: 0.00069, Aligned region: 36..139
AAA_14 [PF13173], Evalue: 0.00069, Aligned region: 410..450
AAA_30 [PF13604], Evalue: 0.0014, Aligned region: 33..57
AAA_30 [PF13604], Evalue: 0.0014, Aligned region: 326..340
AAA_30 [PF13604], Evalue: 0.0014, Aligned region: 408..438
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 36..55
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 192..236
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 412..432
DUF2075 [PF09848], Evalue: 0.0018, Aligned region: 38..138
DUF2075 [PF09848], Evalue: 0.0018, Aligned region: 188..206
DUF2075 [PF09848], Evalue: 0.0018, Aligned region: 411..434
T2SE [PF00437], Evalue: 0.0022, Aligned region: 21..52
T2SE [PF00437], Evalue: 0.0022, Aligned region: 408..487
TIP49 [PF06068], Evalue: 0.0028, Aligned region: 36..57
TIP49 [PF06068], Evalue: 0.0028, Aligned region: 87..116
TIP49 [PF06068], Evalue: 0.0028, Aligned region: 380..433
AAA_33 [PF13671], Evalue: 0.0032, Aligned region: 36..56
AAA_33 [PF13671], Evalue: 0.0032, Aligned region: 411..434
DUF815 [PF05673], Evalue: 0.0071, Aligned region: 27..111
DUF815 [PF05673], Evalue: 0.0071, Aligned region: 412..447
ResIII [PF04851], Evalue: 0.0084, Aligned region: 21..51
ResIII [PF04851], Evalue: 0.0084, Aligned region: 107..119
ResIII [PF04851], Evalue: 0.0084, Aligned region: 384..435
AAA_11 [PF13086], Evalue: 0.0093, Aligned region: 35..58
AAA_11 [PF13086], Evalue: 0.0093, Aligned region: 399..435
PhoH [PF02562], Evalue: 0.0096, Aligned region: 19..57
PhoH [PF02562], Evalue: 0.0096, Aligned region: 411..431
PhoH [PF02562], Evalue: 0.0096, Aligned region: 609..639
NTPase_1 [PF03266], Evalue: 0.0098, Aligned region: 36..59
NTPase_1 [PF03266], Evalue: 0.0098, Aligned region: 412..433
Protein Sequence: 680 a.a.     [Download]
>gi|397657647|ref|YP_006498349.1| clpB protein, partial [Klebsiella oxytoca E718]
MTARARDGKIDPVFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLAIRIAEGNVPDALKPVSV
RTLDLGLLQAGAGVKGEFEQRLKNIIDAVQQSPLPVLLFIDEAHTLIGAGNQAGGADAANLLKPALARGE
LRTIAATTWSEYKQYFERDAALERRFQMIKVDEPDDDTACLMLRGLKSRYAEHHGVHITDEAVRAAVTLS
RRYLTGRQLPDKAVDLLDTASARIRMSLDTVPAPLTRLKAQLTALAMEKQALLEDIAAGNHTHGERLAAI
EQDEVRIILQLDELETQYGQELKLTENLLACRADISRHAEIADLQNQLSAVQQGNPLLGLDVDARTVATV
IADWTGVPLSSLMKDEQTELLSLEQQLGRRVVGQDAALNAIAQRLRASKTGLTSENGPQGVFLLTGPSGT
GKTETALALADALFGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLQDEV
EKAHRDVMNLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDHIMQMLDERPEATESDLHELLRPLLR
DHFQPALLARFQTVIYRPLTRDAMRTIVGMKLSQVSKRLSRHYCMTTTISDSLYDALTDACLLPDTGARN
VDSLLNQQILPALSLQLLSHQAAGQKPQHLILGRDEEGGIVMEFGAGAGV
 
Nucleotide Sequence: 2043 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2778155-2780197 Klebsiella oxytoca E718 chromosome, complete genome
GTGACCGCCCGCGCCCGGGACGGCAAAATCGACCCGGTGTTCGGCCGTGATAATGAAATCCGCCAGATGG
TGGACATTCTTTCCCGACGCCGCAAGAACAACCCGATACTGGTGGGCGAGCCGGGCGTCGGCAAGACCGC
GCTGGTGGAAGGTCTGGCGATCAGAATCGCCGAGGGCAACGTCCCGGACGCGCTGAAACCGGTAAGCGTG
CGCACCCTTGACCTCGGCCTGCTGCAGGCCGGAGCGGGGGTGAAGGGAGAATTCGAGCAGCGGCTGAAAA
ACATTATCGACGCGGTGCAGCAGTCGCCGCTGCCTGTGCTTCTGTTTATTGATGAGGCCCACACCCTTAT
CGGCGCGGGTAACCAGGCGGGCGGCGCCGATGCGGCTAACCTGCTGAAACCGGCCCTTGCCCGGGGCGAA
CTCAGAACTATCGCCGCCACAACCTGGAGCGAGTACAAACAGTATTTTGAGCGCGATGCGGCGCTGGAGC
GGCGCTTCCAGATGATCAAAGTCGATGAGCCGGACGACGACACCGCCTGCCTGATGCTCAGGGGCCTGAA
GTCCCGCTACGCGGAGCATCACGGGGTGCACATCACCGATGAGGCGGTGCGCGCCGCCGTCACCCTTTCC
AGACGCTATCTGACCGGACGCCAGCTGCCGGACAAGGCGGTGGATTTACTCGACACCGCCTCCGCCCGCA
TCCGCATGAGCCTGGATACGGTGCCAGCGCCGCTGACCCGCCTGAAGGCGCAGCTCACCGCCCTGGCGAT
GGAAAAGCAGGCGCTGCTGGAAGATATCGCGGCGGGTAACCACACCCACGGCGAACGCCTGGCGGCCATC
GAACAGGACGAAGTCCGTATTATCCTGCAGCTCGACGAGCTGGAAACGCAGTACGGCCAGGAGCTGAAGC
TCACGGAAAACCTGCTCGCCTGCCGCGCCGATATCTCCCGCCACGCGGAAATCGCGGACCTGCAAAACCA
GCTTAGCGCCGTGCAGCAGGGGAACCCGCTGCTGGGTCTGGACGTGGACGCGCGCACTGTTGCCACGGTC
ATCGCCGACTGGACCGGCGTGCCGCTCTCGTCTCTGATGAAGGATGAGCAGACGGAGCTGCTGAGCCTGG
AACAGCAGCTCGGTAGACGCGTGGTGGGCCAGGACGCGGCGCTGAACGCCATCGCGCAGCGTCTCCGTGC
CAGCAAAACCGGGCTGACGTCGGAGAACGGCCCGCAGGGCGTGTTCCTGCTGACCGGGCCGAGCGGCACC
GGCAAGACTGAAACCGCGCTTGCCCTTGCTGACGCGCTGTTCGGCGGTGAGAAATCCTTAATCACTATCA
ACCTCTCCGAATACCAGGAGCCGCATACCGTCTCCCAGTTGAAAGGCTCTCCTCCGGGCTACGTCGGCTA
CGGCCAGGGCGGGATCCTCACCGAAGCGGTCAGAAAGCGTCCGTACAGCGTGGTGCTGCAGGACGAAGTG
GAGAAGGCCCATCGGGACGTGATGAACCTGTTCTACCAGGTGTTTGACCGGGGTTTTATGCGCGACGGCG
AGGGGCGGGAGATCGACTTTCGCAACACGGTTATTCTGATGACCTCCAACCTCGGCAGCGACCACATCAT
GCAGATGCTGGACGAACGGCCGGAGGCCACGGAATCTGACCTGCATGAACTGCTGCGTCCGCTGCTGCGC
GACCACTTCCAGCCCGCGCTGCTGGCGCGCTTCCAGACGGTGATCTACCGCCCGCTCACGCGGGACGCGA
TGCGCACGATTGTCGGTATGAAGCTCAGCCAGGTGAGCAAACGCCTCAGTCGCCACTACTGCATGACCAC
TACCATCAGCGATAGCCTGTACGACGCTCTGACGGATGCCTGCCTGCTGCCGGATACCGGGGCGCGCAAC
GTGGACAGCCTGCTCAATCAGCAGATATTGCCGGCGCTGAGCCTGCAGCTGTTAAGCCATCAGGCGGCGG
GGCAGAAGCCGCAGCACCTGATACTGGGCCGTGATGAAGAGGGGGGGATTGTGATGGAGTTTGGCGCAGG
GGCGGGCGTATGA