SecReT6
Protein ID: 397657648
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2635
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2780194..2782689 [+]
ProductVgrG protein
NoteTssI
UniProt IDI6WZ45
KEGG IDkoe:A225_2635
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.60E-64, Aligned region: 33..355
DUF2345 [PF10106], Evalue: 3.00E-38, Aligned region: 577..601
DUF2345 [PF10106], Evalue: 3.00E-38, Aligned region: 607..758
T6SS_Vgr [PF13296], Evalue: 4.20E-34, Aligned region: 489..594
T6SS_Vgr [PF13296], Evalue: 4.20E-34, Aligned region: 632..664
Phage_base_V [PF04717], Evalue: 2.60E-18, Aligned region: 343..356
Phage_base_V [PF04717], Evalue: 2.60E-18, Aligned region: 389..483
Fil_haemagg_2 [PF13332], Evalue: 0.0035, Aligned region: 544..592
Fil_haemagg_2 [PF13332], Evalue: 0.0035, Aligned region: 629..741
Protein Sequence: 831 a.a.     [Download]
>gi|397657648|ref|YP_006498350.1| VgrG protein [Klebsiella oxytoca E718]
MSEIKSLLFSHSHHLLTVRGCSALLDVLSFEGEEALSEPFRYVIEFTSADKTITPQQMLMQDATFTLQAP
ADQGFGINIQQPVRTIQGVVTAFERLSASRDETHYSLTLQPRLALLSRSHQNRIYQDMSVPDIVEHILRT
RHAMRGEDFVFTLAQAYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLNIDVVEFYDDQRHYEQG
LVLPSVPPSGQHDGGTESVWALKSQHNVVQQSVFTRDYNYRNAPEEMSQSADVTSGDVTTYGEAYHWADN
YLAPGSDGQRNPEPESGAFYARLRHERYLNDQTRLSGRTSSAALAPGRELKVTGGAEVTEVFRQGVVITG
IHSRARRDRSYEVAFTAIPFSENYGFRPQPGDRPVMAGTLPARVTSTKTNDIYGHIDRDGRYKVNLLFDR
DHWSPGEESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEQGDPDRPYIAGVLHDSAHPDPVTIRNYKRN
VLRTPANNKIRLDDARGKEHIKVSTEYGGKSQLNLGHLVDSEKQPRGEGFELRTDSYGTIRAGKGIFITA
DAQSKAQGQQLAMEPALSRLSAALVEMQSLAASAQQAQALAADVGRQQTLLQQKIDQLQKEVLLGTAPQG
VALASGDDMLLSAQENLTLIAGQQLDMGAQKDFTLAAGKQLSLWSQNGAKWFASRGDIDIQAQGGHITTW
STQDTHISSGKKLVITAQDELTLICGGGYIKIKGGNVEIGGPGKLLIKNTGIKKAGSGSMQGVIKSFESG
SFDEKFVIRNSLTKEPLANKAYSITMPDGRIVSGVTDLNGSTSLNASDVIDDMTITLIKGR
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2780194-2782689 Klebsiella oxytoca E718 chromosome, complete genome
ATGAGCGAGATAAAATCCCTGCTGTTCAGCCACAGCCACCATCTGTTAACGGTGCGCGGCTGCAGCGCCC
TTCTGGACGTGCTGAGCTTTGAAGGTGAGGAAGCCCTGAGCGAACCGTTCAGATACGTAATTGAGTTCAC
CAGCGCCGACAAAACCATCACGCCGCAGCAGATGCTGATGCAGGACGCGACCTTCACCCTGCAGGCGCCG
GCGGACCAGGGTTTCGGGATTAACATTCAGCAGCCGGTGCGCACGATTCAGGGCGTGGTGACGGCGTTTG
AGCGCCTTTCCGCATCCCGCGACGAAACGCACTATTCCCTGACCCTGCAGCCCCGTCTGGCGCTGCTCTC
CCGGAGCCACCAGAACCGGATTTACCAGGATATGTCGGTGCCGGATATCGTGGAGCATATCCTGCGTACC
CGCCACGCCATGCGCGGGGAGGACTTTGTTTTCACCCTGGCACAGGCGTATCCGCGTCGCGAGCAGGTGA
TGCAGTACGGCGAGGACGACCTGCGCTTTATCACCCGCCTGCTGGGCGAGGTCGGTATCTGGTTCCGCTT
CACCGCCGACACCCGGCTGAACATTGACGTGGTGGAGTTTTACGATGACCAGCGGCACTACGAGCAGGGG
CTGGTTCTGCCGTCGGTGCCGCCCTCCGGCCAGCACGACGGCGGTACCGAGTCGGTGTGGGCGCTGAAAA
GCCAGCATAACGTGGTGCAGCAGTCGGTGTTCACCCGGGACTACAACTACCGCAATGCGCCGGAGGAGAT
GAGCCAGAGCGCGGACGTGACGTCCGGCGACGTCACCACCTACGGCGAGGCGTATCACTGGGCGGATAAC
TACCTGGCGCCGGGCAGCGACGGCCAGCGCAACCCGGAGCCGGAGAGCGGGGCGTTTTATGCCCGTCTGC
GCCACGAGCGCTACCTGAACGACCAGACCCGGCTGAGCGGCAGGACCAGCAGCGCGGCGCTGGCGCCGGG
CCGGGAGCTGAAGGTCACCGGAGGCGCTGAGGTGACGGAGGTTTTCCGCCAGGGCGTGGTGATTACCGGC
ATCCACAGCCGCGCCCGTCGCGACCGCAGCTATGAGGTGGCGTTTACGGCCATCCCGTTCTCGGAAAATT
ACGGCTTCCGTCCGCAACCGGGCGACAGGCCGGTCATGGCCGGCACGCTGCCGGCGCGGGTGACCAGCAC
GAAAACCAACGATATCTACGGCCATATCGACCGCGACGGCCGTTATAAGGTCAACCTGCTGTTCGACCGC
GATCACTGGTCGCCGGGGGAAGAGAGTCTGTGGGTACGTCAGGCGCGCCCCTATGCCGGGGACACATACG
GCCTGCACCTGCCGCTGCTGGCGGGGACGGAAGTGGCCATCGCTTTTGAGCAGGGAGACCCGGACCGTCC
GTATATTGCCGGTGTCCTGCACGACTCGGCGCACCCGGACCCTGTCACTATCCGGAACTATAAGCGCAAC
GTCCTGCGGACCCCGGCGAACAACAAAATCCGCCTCGACGACGCGCGTGGCAAAGAGCACATCAAGGTCA
GCACGGAGTACGGCGGCAAGAGCCAGCTGAACCTGGGGCATCTGGTGGACAGCGAAAAACAGCCACGCGG
CGAGGGGTTTGAGCTGCGGACGGATAGTTACGGGACTATCCGCGCCGGGAAGGGAATATTCATTACTGCT
GATGCACAATCGAAGGCGCAGGGGCAGCAGCTGGCGATGGAACCGGCGCTGTCGCGGCTTTCAGCGGCAC
TAGTGGAAATGCAGTCACTGGCTGCCAGCGCACAGCAGGCACAGGCGCTGGCTGCGGATGTTGGACGTCA
GCAGACGTTGCTGCAACAGAAGATAGACCAGCTTCAGAAGGAAGTACTGCTGGGAACGGCCCCGCAGGGT
GTGGCGCTGGCAAGCGGTGACGATATGCTGCTGTCGGCGCAGGAGAATCTGACGCTGATTGCAGGTCAGC
AGCTGGATATGGGGGCGCAGAAGGACTTCACACTGGCGGCGGGTAAACAACTCAGTCTCTGGAGTCAGAA
TGGGGCGAAGTGGTTTGCGTCGCGGGGAGATATTGATATTCAGGCGCAGGGCGGACATATCACCACTTGG
TCAACGCAGGACACGCATATTTCGAGTGGCAAGAAGCTGGTAATAACAGCACAGGATGAACTGACGCTGA
TATGCGGGGGCGGATATATCAAAATCAAAGGTGGGAATGTTGAAATTGGCGGTCCTGGAAAGTTGCTGAT
AAAAAACACCGGTATTAAGAAAGCAGGTTCGGGTAGTATGCAGGGAGTAATAAAGTCGTTTGAGTCGGGA
AGTTTTGATGAGAAGTTTGTCATTCGAAATTCTCTGACCAAAGAACCTTTAGCCAATAAGGCATATTCAA
TAACCATGCCGGATGGAAGGATTGTTTCAGGGGTGACAGATTTAAATGGTTCTACATCATTAAATGCCTC
GGATGTCATTGATGATATGACTATCACTCTTATTAAAGGTAGGTAA