SecReT6
Protein ID: 397657653
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2640
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2790365..2792125 [+]
Productprotein ImpG/VasA
NoteTssF
UniProt IDI6WZ48
KEGG IDkoe:A225_2640
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-181, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|397657653|ref|YP_006498355.1| protein ImpG/VasA [Klebsiella oxytoca E718]
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAALNLDKSGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTGGLVSMIWPHYLRTIPSLSIVEFTADWRELKEPVRVEKGFGILSQPIGEKRTRCHYTTTQSLILQPLS
LARAGISTEPDGRSLLRLRFECSPLADWSRIDLSRIPLYLNGDAPLACALHEALTLRVAKTGIRFPGDAD
RRPLDARFAVCGFSREEALLPECGSFSGYQLLLEYFTFREKFMSVTLRGLENMDFPEELAWFEIDIVLER
QWPHEYALSEKHLRLHCTPVINLFPLESDPLHLDSLQTEYLLRPMRVQDGHTEIYSVDSVTSSRHSGHQT
YVPFTSFRHKGGMLRHDAPEYYYHTRVKSGPSGLHDTWLTLGGEAFDNHTVPENEKLSLSLTGTNGQLPR
RALQSTLLDTVVKSTTARIQVRNLCAPTLPCYPPDRDRFHWRVLSHLGSSFLWMMDNADVLRGALALYDW
TDNEMNRRRLEAIVDVRHSEVERFAQGHFLRGVQIEVTLDSSGFAGHGDICLFGEMLNRFFALYTDIHLF
NHLILILQPGGERLEWQENHNRRIPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2790365-2792125 Klebsiella oxytoca E718 chromosome, complete genome
ATGGACGACTTAACCCTGCGTTATTTTGACGCCGAAATGCGTTACCTGCGTGAAGCGGGCGAAGAGTTCG
CCCGCGCCCATCCTGACCGGGCGGCGGCCTTAAATCTCGACAAATCGGGCGCGCGCGACCCCTATGTCGA
GCGCCTGTTTGAAGGCTTCGCCTTTCTGATGGGCCGCCTGCGCGAAAAGCTCGACGACGATCTGCCGGAG
CTGACCGGCGGACTGGTGAGCATGATCTGGCCACACTACCTGCGTACCATTCCGTCGCTCTCCATTGTTG
AGTTCACCGCGGACTGGCGTGAACTGAAAGAACCTGTCCGCGTTGAAAAAGGCTTTGGAATTCTTTCTCA
GCCCATTGGTGAAAAGCGCACCCGCTGCCATTACACCACGACGCAGTCGCTGATCCTGCAGCCCCTGTCG
CTCGCCCGGGCGGGGATCTCGACGGAACCGGATGGGCGCTCGCTTCTCCGCCTGCGCTTTGAGTGCAGCC
CGCTGGCAGACTGGAGCCGCATCGATTTAAGCCGCATCCCGCTGTACCTGAATGGCGACGCGCCACTGGC
CTGCGCCTTGCATGAGGCGCTGACGCTCCGGGTGGCGAAAACGGGTATCCGCTTTCCCGGCGATGCTGAC
CGCAGACCGCTGGACGCCCGTTTTGCCGTCTGCGGTTTCAGTAGGGAGGAGGCGCTGCTGCCGGAGTGCG
GCAGTTTCAGCGGTTATCAGCTGCTGCTGGAGTATTTTACCTTCCGTGAAAAGTTTATGTCGGTGACGCT
GCGCGGCCTGGAAAATATGGATTTCCCGGAAGAACTGGCGTGGTTTGAAATCGATATCGTGCTGGAGAGA
CAGTGGCCGCATGAATATGCGCTGTCGGAGAAACATCTGCGCCTGCACTGCACGCCGGTGATTAATCTGT
TTCCGCTGGAGTCCGATCCGCTGCATCTGGACTCGTTACAGACCGAATACCTGCTGCGCCCGATGCGTGT
CCAGGACGGTCATACCGAGATTTATTCCGTGGATTCGGTCACCTCCTCGCGCCACTCCGGTCACCAGACG
TATGTGCCGTTCACCAGCTTCCGTCACAAGGGAGGAATGCTGCGCCATGATGCGCCGGAATATTATTACC
ATACGCGGGTAAAGTCCGGTCCTTCAGGGCTGCACGACACCTGGCTGACGCTCGGCGGCGAGGCGTTTGA
TAACCACACCGTACCGGAGAATGAAAAACTGTCGCTCAGCCTGACCGGCACCAACGGCCAGCTGCCGCGC
CGGGCGCTGCAGAGTACGCTGCTGGACACGGTGGTGAAATCCACCACCGCGCGCATTCAGGTGCGTAACC
TCTGCGCCCCGACGCTGCCGTGCTACCCGCCGGACCGCGATCGTTTTCACTGGCGGGTGCTGAGCCATCT
CGGCAGCAGTTTCCTGTGGATGATGGATAACGCCGACGTGCTGCGCGGCGCGCTGGCCCTCTATGACTGG
ACCGATAACGAGATGAACCGCCGCCGCCTGGAAGCGATTGTCGATGTCAGGCATAGCGAGGTGGAACGTT
TTGCACAGGGCCATTTTCTGCGCGGCGTGCAGATTGAGGTGACCCTCGACAGCAGCGGCTTCGCCGGGCA
CGGCGATATCTGCCTGTTCGGCGAGATGCTGAACCGCTTCTTCGCGCTGTATACCGATATTCACCTGTTC
AACCATCTGATTCTGATACTACAACCTGGGGGAGAGCGCCTCGAATGGCAGGAGAACCACAACCGCCGCA
TTCCCGGCTAA