SecReT6
Protein ID: 397657654
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2641
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2792089..2793174 [+]
Producthypothetical protein
NoteTssG
UniProt IDI6WP59
KEGG IDkoe:A225_2641
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.60E-78, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|397657654|ref|YP_006498356.1| hypothetical protein A225_2641 [Klebsiella oxytoca E718]
MAGEPQPPHSRLSPRLEREIYRINFYRFCQLLEKRRPGASPLGSTLNPADDPVRFRPHPGMGFPVSELKA
VEYDEDHPDAPPTVRTTFMGLYGVDSPLPTAWLDEIAQQREGHEAQEAFLDIFNHRILTQFYRIWRKYSY
PATFEAGGRDSTSQSLLGLIGLGMPGTDKHIATPISRFLALLGIMRLPARTEEGIQALVRLLAPRTRTTV
TPHCPRTFFINNPLGFYGNDDFLLDGYNVLGDETTEVSSQLLIALYTDDIAEAQGWLPEGQIYQDFLVLL
RVYLGWRYKARIQLTVPARLLPAPVLGETPFMLGMTGILGVEGEEIPPDIPATFTIEPGGYCGMPSATLQ
QGNQRVAYHFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2792089-2793174 Klebsiella oxytoca E718 chromosome, complete genome
ATGGCAGGAGAACCACAACCGCCGCATTCCCGGCTAAGCCCCCGGCTTGAGCGGGAAATCTATCGTATCA
ACTTCTACCGCTTCTGCCAGTTACTGGAAAAGCGTCGTCCGGGCGCATCGCCGTTGGGCAGCACCCTGAA
TCCAGCGGACGATCCGGTACGGTTTCGCCCGCATCCGGGAATGGGCTTCCCGGTCAGCGAGCTGAAAGCG
GTGGAATATGATGAAGACCATCCGGATGCGCCGCCGACGGTGCGCACGACGTTTATGGGGCTCTACGGCG
TCGACTCGCCGCTGCCCACCGCGTGGCTCGACGAGATCGCCCAGCAGCGGGAAGGGCACGAAGCGCAGGA
GGCGTTTCTCGATATCTTTAACCACCGCATTCTGACGCAGTTTTACCGCATCTGGCGAAAATATTCCTAC
CCGGCGACGTTTGAAGCGGGGGGCAGGGACAGCACCTCGCAGAGCCTGCTGGGCCTTATCGGTCTGGGAA
TGCCGGGTACCGATAAGCATATCGCCACCCCGATATCGCGTTTTCTGGCGCTGCTCGGCATCATGCGCCT
GCCTGCGCGTACCGAAGAGGGGATTCAGGCGCTGGTACGTCTGCTGGCTCCCCGCACGCGGACCACCGTC
ACGCCGCACTGCCCGCGCACGTTTTTCATCAACAATCCACTGGGTTTTTACGGCAATGACGATTTTCTGC
TCGATGGCTATAACGTGCTGGGCGACGAAACGACAGAGGTCAGCAGCCAGCTATTGATTGCGCTGTACAC
GGACGATATCGCCGAGGCGCAGGGGTGGTTACCGGAAGGGCAGATATATCAGGACTTTCTGGTCCTGCTG
CGGGTCTATCTTGGCTGGCGCTATAAAGCGCGTATACAGCTGACCGTTCCTGCCCGGTTACTGCCTGCGC
CGGTGCTGGGCGAAACCCCCTTTATGCTCGGCATGACGGGGATACTGGGCGTGGAGGGAGAGGAGATCCC
GCCCGATATCCCCGCCACCTTTACTATTGAGCCTGGCGGCTATTGCGGAATGCCGTCTGCAACTTTACAA
CAAGGAAACCAGCGTGTTGCATACCACTTTGATTAA