SecReT6
Protein ID: 397657655
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2642
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2793194..2793691 [+]
Producthypothetical protein
NoteTssJ
UniProt IDI6W5A4
KEGG IDkoe:A225_2642
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-33, Aligned region: 3..155
Protein Sequence: 165 a.a.     [Download]
>gi|397657655|ref|YP_006498357.1| hypothetical protein A225_2642 [Klebsiella oxytoca E718]
MPLLLTGCGLTQKISDSTSSAVKSVFYKQVNVLHLDVTARAELNTDERENTSLSQPVMVWVYQLSDRKAF
DKRVYQQLVTESEEAAGDERLASRSLVVKPGADVSLDMPMDEKAQFIAVVGLFRAPDMVKNDWKLVLRRD
DLDPDKPRIIEASHNRLTLKPLKDD
 
Nucleotide Sequence: 498 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2793194-2793691 Klebsiella oxytoca E718 chromosome, complete genome
ATGCCTTTACTGCTGACAGGCTGTGGCCTGACGCAGAAAATTAGCGACAGCACCTCATCGGCGGTGAAAT
CGGTGTTTTATAAGCAGGTAAACGTCCTGCATCTGGACGTTACCGCCCGGGCGGAACTGAACACCGATGA
GCGGGAGAACACCTCGCTCTCCCAGCCGGTGATGGTGTGGGTCTACCAGCTCAGTGACCGCAAGGCGTTC
GATAAACGGGTCTATCAGCAGCTGGTCACGGAAAGCGAGGAGGCCGCCGGAGACGAACGGCTTGCCAGCC
GTAGCCTGGTGGTAAAACCCGGCGCTGACGTCAGCCTGGATATGCCGATGGACGAGAAGGCGCAGTTTAT
CGCGGTAGTGGGGTTATTCCGGGCGCCGGATATGGTGAAGAATGACTGGAAGCTGGTGCTGAGGCGCGAC
GATCTCGATCCCGACAAACCGCGCATTATTGAAGCCAGCCATAACCGCCTGACGCTGAAACCCCTGAAGG
ATGACTGA