SecReT6
Protein ID: 397657656
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2643
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2793693..2794148 [+]
Producthypothetical protein
NoteTssE
UniProt IDI6X262
KEGG IDkoe:A225_2643
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.20E-14, Aligned region: 31..117
Protein Sequence: 151 a.a.     [Download]
>gi|397657656|ref|YP_006498358.1| hypothetical protein A225_2643 [Klebsiella oxytoca E718]
MPTRHNAPSLYEMLYGNFTGGLDLHQVSEENQVILSVLDNMQRVLNCRAGTLAHLPDYGLPDMTKILQGM
PGTAHELMGILSAVLLKYEPRLKKIDVVLLEQAIPGELRYAIDAELKGVGLVRYGTEFMPEGRVLIRHLK
QQQYLEVRSSI
 
Nucleotide Sequence: 456 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2793693-2794148 Klebsiella oxytoca E718 chromosome, complete genome
ATGCCCACACGCCATAATGCCCCCTCGCTGTATGAAATGCTGTACGGCAACTTTACCGGCGGACTCGACC
TGCATCAGGTCAGTGAAGAAAACCAGGTTATTCTGTCGGTGCTGGATAATATGCAGCGCGTCCTCAACTG
TCGCGCCGGGACGCTGGCGCACCTGCCCGATTACGGCCTGCCGGATATGACTAAAATCCTCCAGGGGATG
CCGGGTACGGCTCATGAGCTGATGGGCATCCTGTCGGCCGTATTGCTTAAATATGAACCGCGGCTGAAGA
AAATTGACGTGGTTCTGCTCGAGCAGGCTATTCCCGGCGAGCTGCGTTACGCCATTGACGCGGAGCTGAA
GGGCGTAGGCCTGGTGCGCTACGGCACCGAATTTATGCCCGAGGGCAGGGTGCTTATCCGCCACCTCAAA
CAGCAGCAGTACCTGGAAGTCCGCTCCTCTATCTAG