SecReT6
Protein ID: 397657657
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2644
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2794172..2795506 [+]
Producthypothetical protein
NoteTssA
UniProt IDI6VUQ7
KEGG IDkoe:A225_2644
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 6.70E-51, Aligned region: 92..152
DUF3702 [PF12486], Evalue: 6.70E-51, Aligned region: 275..287
DUF3702 [PF12486], Evalue: 6.70E-51, Aligned region: 295..440
ImpA-rel_N [PF06812], Evalue: 4.00E-18, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 4.00E-18, Aligned region: 343..366
Protein Sequence: 444 a.a.     [Download]
>gi|397657657|ref|YP_006498359.1| hypothetical protein A225_2644 [Klebsiella oxytoca E718]
MTTPSECCLKTGGDPRTLADYARLRDEMNKLTHPARPDVNWRLAEKLCLSLFEHNGVELQTAAWYTLVRM
HLAGLYGMNEGLAILVALVSRQWGNMWPQPTTARIKILSSLSQRLQQAMRTLSLTYIDLSQLYQAEAHLT
ALDDVLQRLELKHAGQLDALSILLHNAAVRLESSENKEETAPQAAAPDPAPSSLPEPTAQVKWVYVAEPA
SRPNADVVTAFPAPAKPWKPFVAGMLTMLALAGAAAGGWRATHPSDSGQMRFPARFSPLPTVLSAEQLQT
LRQQSPSAEPGIKQTQQQLAQLLQLKPDWALSYGTHLAQQALTLWPEQAKPLARQWQQQVSAAALPVENL
SGWHQGMTQLQQLTNRLNALDEQKGRYITVSELKSAVFAITQSFSRTVPAEEQLRQLSAQPRNQPGSAAQ
QNQTEQHLQQLIARYAALKQKTAE
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2794172-2795506 Klebsiella oxytoca E718 chromosome, complete genome
ATGACGACCCCTTCTGAATGTTGCCTGAAAACCGGCGGCGACCCGCGTACGCTTGCAGATTACGCGCGCC
TTCGCGATGAAATGAACAAACTGACCCATCCGGCGCGCCCTGATGTCAACTGGCGGCTCGCGGAAAAACT
CTGCCTGTCGCTGTTTGAGCACAACGGCGTGGAGCTACAGACTGCCGCCTGGTATACGCTTGTCCGCATG
CATCTGGCGGGGCTATACGGCATGAATGAAGGGCTGGCGATACTGGTCGCGCTGGTCTCCCGGCAGTGGG
GCAATATGTGGCCGCAGCCGACGACTGCGCGAATCAAAATACTCAGTTCGCTCAGTCAACGGCTGCAGCA
GGCGATGCGCACGCTGTCGCTGACCTATATCGACCTGAGCCAGCTTTACCAGGCAGAAGCGCATCTGACG
GCGCTGGATGACGTACTGCAGCGTCTGGAACTCAAACATGCCGGCCAGCTTGATGCCCTGTCTATCCTGC
TGCACAACGCGGCGGTACGGCTGGAGAGCAGCGAAAATAAAGAGGAGACCGCGCCGCAAGCGGCCGCGCC
TGATCCTGCCCCTTCCAGCCTCCCTGAACCGACCGCGCAGGTGAAATGGGTCTATGTCGCCGAACCGGCA
TCGCGGCCGAATGCTGACGTTGTGACGGCATTCCCGGCGCCCGCGAAGCCCTGGAAGCCGTTTGTCGCCG
GGATGCTGACTATGCTGGCGCTGGCCGGGGCCGCGGCGGGAGGATGGCGGGCAACGCACCCGTCCGATTC
GGGGCAGATGCGGTTTCCCGCCCGGTTCTCTCCATTGCCTACGGTGCTTTCCGCTGAGCAGTTACAGACG
CTACGACAACAATCCCCCTCGGCGGAGCCGGGGATAAAACAGACTCAGCAGCAGCTGGCGCAGCTTTTAC
AGCTAAAACCGGACTGGGCTTTGAGTTATGGTACTCATCTGGCGCAGCAGGCGCTGACGCTATGGCCAGA
GCAGGCGAAACCGCTGGCGCGGCAATGGCAACAGCAGGTCAGCGCCGCCGCGCTTCCCGTGGAGAATCTC
AGCGGCTGGCACCAGGGAATGACGCAGCTACAGCAGTTGACGAACCGGCTTAACGCACTGGATGAACAGA
AGGGGCGGTATATCACGGTGAGTGAGCTGAAGTCAGCGGTGTTTGCCATAACGCAGTCGTTCAGCCGTAC
CGTTCCGGCGGAAGAGCAGCTGCGACAACTCTCCGCACAGCCGCGCAATCAGCCAGGGTCTGCGGCGCAG
CAGAACCAGACGGAGCAGCATCTGCAACAACTGATTGCCCGCTATGCTGCGCTGAAACAAAAAACGGCGG
AATAA