SecReT6
Protein ID: 397658360
SecReT6 ID678
T6SS typei2
Gene symbol-
Locus tagA225_3358
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3529603..3530148 [-]
Producthypothetical protein
NoteTssJ
UniProt IDI6WQP4
KEGG IDkoe:A225_3358
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-35, Aligned region: 19..171
Protein Sequence: 181 a.a.     [Download]
>gi|397658360|ref|YP_006499062.1| hypothetical protein A225_3358 [Klebsiella oxytoca E718]
MLSTNLIKPACWLSALLAFSLAGCGVTQSITDGTKAVYTAVFYKKIKVLHLDFIAREALNTDSRESNSLS
EPVVVRVYQLKDRKNFDKTVYQQLLKNGDTILKADLLATRDVVIKPGGDANLDMPMEERAQFVAVAGLFR
HPDMVNNTWKQVLRREDLDPDKPRVLEAGNNHFALQPLKED
 
Nucleotide Sequence: 546 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3530148-3529603 Klebsiella oxytoca E718 chromosome, complete genome
GTGCTAAGTACAAATTTGATTAAACCCGCGTGCTGGCTATCTGCACTACTGGCGTTCAGCCTGGCAGGCT
GTGGGGTGACGCAGAGTATTACGGATGGCACCAAAGCGGTGTATACGGCGGTGTTTTATAAGAAGATTAA
GGTGCTGCATCTGGATTTTATAGCCCGTGAAGCACTGAATACGGATTCCCGCGAGAGTAACTCACTGTCT
GAGCCGGTGGTGGTTCGTGTCTACCAGTTGAAAGACCGCAAAAACTTCGACAAAACGGTTTATCAGCAAC
TCCTCAAGAACGGCGACACGATCCTGAAAGCCGACCTGCTGGCGACCCGCGACGTGGTGATAAAGCCGGG
TGGGGATGCGAATCTTGATATGCCAATGGAAGAACGCGCGCAGTTTGTCGCGGTGGCCGGACTGTTCCGC
CATCCGGATATGGTCAACAATACCTGGAAGCAGGTTCTCAGACGTGAAGATCTCGATCCGGATAAACCCC
GTGTTCTGGAAGCCGGAAATAACCACTTTGCATTACAGCCGCTGAAGGAGGACTAA